KEGG   Ustilago maydis: UM04561.1Help
Entry
UM04561.1         CDS       T01021                                 

Definition
hypothetical protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
uma  Ustilago maydis
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:uma00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    UM04561.1
Enzymes [BR:uma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     UM04561.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
13
AA seq 359 aa AA seqDB search
MSSFTAVSSSTRPFCLVKSSINIDETFLVPHIVRPGETISSSELVSRPGGKGANVSAAIA
LAGASVSFSGAVGKDAPWPLDELKARHVMIDGAEILDNTPTGRAFIQIAEDGENSIVLLK
GANFATHSRSADPVKSWTSQITHLVLQNEIPLPTTIAFLQHAKSKKVEGHVTTIFNPSPM
LTQSQVEQFPWTSIDVLVVNEGESIELLRVLQPDAAKSLESLPEGEDRSTRVLQALSSVE
QLQETAWLVLTRGGEGVMANVILSESQTKRSFFNVAPFKPRQVKDTTGAGDTFAGNLVAA
LMGHNVDADRGLVKSARPTEAKFVEDALKWASKAASLACEKEGAMQSIPSAEEVKARSA
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgagctcattcaccgctgtctcttcttcaaccaggcctttctgcctcgtcaaatcgtcc
atcaacatcgacgaaactttcctggtaccacacattgtccgaccgggcgaaaccatctct
tcgtctgagcttgtctctcgccccggtggcaagggggccaacgtctcagcagctatcgca
cttgcgggtgcatctgtctccttctcaggtgctgtcggcaaggacgcgccatggccacta
gacgagctcaaagctcgccatgtcatgattgatggtgccgagattctcgacaatactccg
acgggccgagctttcatccagattgcagaagatggcgagaacagcattgtcttgctcaag
ggagccaactttgcaacacacagcaggtcagctgatcctgtcaaatcttggacatctcaa
atcacgcacttggtgctgcaaaacgagatcccgttaccgacgacgattgccttcttgcag
catgccaagtcaaagaaagtagagggccatgtgacgacaattttcaatccctctcctatg
ctcacgcagagccaagtggaacagttcccatggacgagcatcgatgtcttggttgtcaac
gaaggagaaagcatcgagcttcttcgtgttcttcaacctgatgcagccaagtcgctcgaa
tcgcttccagaaggagaggacagatcaactcgagtcttgcaagcgctttcatcggtcgag
cagcttcaagagactgcatggctcgtgcttacgcgtggcggtgagggagtaatggccaac
gtgatactttcagagagccaaactaagcgaagttttttcaacgttgcgccgttcaagcca
agacaggtcaaggatacaacgggcgcaggcgatacgtttgcaggtaatctcgtagctgct
ctcatgggtcacaatgtggatgcggatcgagggctggtcaagtcggctaggccaaccgag
gcgaaattcgtagaggatgcattgaaatgggcctccaaagcggcaagtctggcatgcgag
aaggaaggcgctatgcagagcataccgagtgcggaagaggtcaaagcgaggagcgcataa

DBGET integrated database retrieval system