KEGG   Ustilago maydis: UM04629.1Help
Entry
UM04629.1         CDS       T01021                                 

Definition
similar to S60200 acetyl-CoA carboxylase (EC 6.4.1.2) - smut fungus (Ustilago maydis)
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
uma  Ustilago maydis
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Class
Metabolism; Overview; Fatty acid metabolism [PATH:uma01212]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:uma00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:uma00640]
Metabolism; Lipid metabolism; Fatty acid biosynthesis [PATH:uma00061]
Metabolism; Biosynthesis of other secondary metabolites; Aflatoxin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
13
AA seq 2185 aa AA seqDB search
MPPPDHKAVSQFIGGNPLETAPASPVADFIRKQGGHSVITKVLICNNGIAAVKEIRSIRK
WAYETFGDERAIEFTVMATPEDLKVNADYIRMADQYVEVPGGSNNNNYANVDLIVDVAER
AGVHAVWAGWGHASENPRLPESLAASKHKIIFIGPPGSAMRSLGDKISSTIVAQHADVPC
MPWSGTGIKETMMSDQGFLTVSDDVYQQACIHTAEEGLEKAEKIGYPVMIKASEGGGGKG
IRKCTNGEEFKQLYNAVLGEVPGSPVFVMKLAGQARHLEVQLLADQYGNAISIFGRDCSV
QRRHQKIIEEAPVTIAPEDARESMEKAAVRLAKLVGYVSAGTVEWLYSPESGEFAFLELN
PRLQVEHPTTEMVSGVNIPAAQLQVAMGIPLYSIRDIRTLYGMDPRGNEVIDFDFSSPES
FKTQRKPQPQGHVVACRITAENPDTGFKPGMGALTELNFRSSTSTWGYFSVGTSGALHEY
ADSQFGHIFAYGADRSEARKQMVISLKELSIRGDFRTTVEYLIKLLETDAFESNKITTGW
LDGLIQDRLTAERPPADLAVICGAAVKAHLLARECEDEYKRILNRGQVPPRDTIKTVFSI
DFIYENVKYNFTATRSSVSGWVLYLNGGRTLVQLRPLTDGGLLIGLSGKSHPVYWREEVG
MTRLMIDSKTCLIEQENDPTQIRSPSPGKLVRFLVDSGDHVKANQAIAEIEVMKMYLPLV
AAEDGVVSFVKTAGVALSPGDIIGILSLDDPSRVQHAKPFAGQLPDFGMPVIVGNKPHQR
YTALVEVLNDILDGYDQSFRMQAVIKELIETLRNPELPYGQASQILSSLGGRIPARLEDV
VRNTIEMGHSKNIEFPAARLRKLTENFLRDSVDPAIRGQVQITIAPLYQLFETYAGGLKA
HEGNVLASFLQKYYEVESQFTGEADVVLELRLQADGDLDKVVALQTSRNGINRKNALLLT
LLDKHIKGTSLVSRTSGATMIEALRKLASLQGKSTAPIALKAREVSLDADMPSLADRSAQ
MQAILRGSVTSSKYGGDDEYHAPSLEVLRELSDSQYSVYDVLHSFFGHREHHVAFAALCT
YVVRAYRAYEIVNFDYAVEDFDVEERAVLTWQFQLPRSASSLKERERQVSISDLSMMDNN
RRARPIRELRTGAMTSCADVADIPELLPKVLKFFKSSAGASGAPINVLNVAVVDQTDFVD
AEVRSQLALYTNACSKEFSAARVRRVTYLLCQPGLYPFFATFRPNEQGIWSEEKAIRNIE
PALAYQLELDRVSKNFELTPVPVSSSTIHLYFARGIQNSADTRFFVRSLVRPGRVQGDMA
AYLISESDRIVNDILNVIEVALGQPEYRTADASHIFMSFIYQLDVSLVDVQKAIAGFLER
HGTRFFRLRITGAEIRMILNGPNGEPRPIRAFVTNETGLVVRYETYEETVADDGSVILRG
IEPQGKDATLNAQSAHFPYTTKVALQSRRSRAHALQTTFVYDFIDVLGQAVRASWRKVAA
SKIPGDVIKSAVELVFDEQENLREVKRAPGMNNIGMVAWLVEVLTPEYPAGRKLVVIGND
VTIQAGSFGPVEDRFFAAASKLARELGVPRLYISANSGARIGLATEALDLFKVKFVGDDP
AKGFEYIYLDDESLQAVQAKAPNSVMTKPVQAADGSVHNIITDIIGKPQGGLGVECLSGS
GLIAGETSRAKDQIFTATIITGRSVGIGAYLARLGERVIQVEGSPLILTGYQALNKLLGR
EVYTSNLQLGGPQIMYKNGVSHLTAQDDLDAVRSFVNWISYVPAQRGGPLPIMPTTDSWD
RAVTYQPPRGPYDPRWLINGTKAEDGTKLTGLFDEGSFVETLGGWATSVVTGRARLGGIP
VGVIAVETRTLERVVPADPANPNSTEQRIMEAGQVWYPNSAYKTAQAIWDFDKEGLPLVI
LANWRGFSGGQQDMYDEILKQGSKIVDGLSSYKQPVFVHIPPMGELRGGSWVVVDSAIND
NGMIEMSADVNSARGGVLEASGLVEIKYRADKQRATMERLDSVYAKLSKEAAEATDFTAQ
TTARKALAEREKQLAPIFTAIATEYADAHDRAGRMLATGVLRSALPWENARRYFYWRLRR
RLTEVAAERTVGEANPTLKHVERLAVLRQFVGAAASDDDKAVAEHLEASADQLLAASKQL
KAQYILAQISTLDPELRAQLAASLK
NT seq 6558 nt NT seq  +upstreamnt  +downstreamnt
atgccgcctccggatcacaaggcagtcagccagtttatcggcggcaacccgcttgaaacc
gctcccgccagccctgttgccgactttattcgcaaacagggtggtcacagtgtcatcacc
aaggtcctcatttgcaacaacggtatcgccgccgtcaaggagattcgctccatccgaaaa
tgggcctacgagacctttggcgatgagcgtgccattgaatttaccgtcatggccacccct
gaggacctcaaagtcaatgccgactacatccgcatggccgaccaatacgtcgaggtaccc
ggtggctctaacaacaacaactacgctaacgtcgacctcatcgtcgatgtcgctgagcga
gccggcgttcacgccgtatgggctggctggggtcacgcctccgagaacccacgcctacct
gaatcgctcgccgcctccaagcacaagatcatctttatcggtccccccggctccgccatg
cgctcgcttggtgacaagatctcgtccaccatcgtcgcacagcacgccgacgtgccatgc
atgccctggtccggtaccggcatcaaggagaccatgatgagcgatcagggtttcctgacc
gtctcggacgacgtctaccaacaggcctgcatccacaccgctgaagaaggtcttgagaag
gccgaaaagatcggctaccccgtcatgatcaaggcctccgaaggtggaggaggaaagggt
atccgaaagtgtaccaacggcgaagaattcaagcagctctacaacgccgttctcggtgaa
gtgcccggctcgcccgttttcgttatgaaactcgccggccaggcgcgtcatctcgaggtg
cagctgctggccgatcagtacggcaacgccatcagcatctttggtcgtgactgctctgtc
cagcgtcgtcaccaaaagatcatcgaggaggctcctgtcactatcgctcctgaggatgcc
cgcgagtccatggagaaggctgccgtgcgtctcgccaaactggtcggctacgtctctgcc
ggtaccgtcgaatggctctactctcccgagtcgggcgagtttgccttcctcgagctcaac
ccccgtcttcaggtcgagcaccctactaccgagatggtctcgggtgtcaacattcccgct
gcccagcttcaggtcgccatgggtatccctctctactcgatccgcgacatccgaaccctt
tacggcatggaccctcgcggtaatgaggtcatcgactttgacttctctagccccgagtcg
ttcaagacccagcgcaagcctcagccccagggccacgtagtcgcctgccgtatcactgcc
gaaaaccccgacaccggcttcaagcctggcatgggtgccctcactgagctcaacttccgc
tccagcacctccacctggggttacttctccgtcggcaccagcggtgctctccacgagtac
gccgattcgcagttcggacacatctttgcctatggtgccgaccgatccgaggcgcgaaaa
cagatggtcatctcgctcaaggagctctccattcgcggtgacttccgtaccaccgtcgaa
tacctcatcaagttgctcgagaccgacgccttcgagtccaacaagatcaccactggatgg
ctcgatggtctcattcaggaccgtctcactgccgaacgacctcctgcggacctcgctgtc
atttgcggtgctgccgtcaaggctcatctccttgcgcgtgagtgcgaggacgagtacaag
cgcatcttgaatagaggtcaggtccctcctcgcgacaccatcaagaccgtcttctcgatc
gacttcatctacgagaacgtcaagtacaactttactgccacgcgcagctccgtctccggc
tgggtcctctacctcaacggtggacgtacgctggtgcagctccgaccccttaccgacgga
ggtctgctcattggtctttcgggcaagtcgcaccccgtctactggcgtgaggaggtcggc
atgacccgtctcatgatcgactccaagacctgcctcatcgagcaggagaatgaccccacc
cagatccgctcgccctcgcccggtaagctcgttcgcttcttggtggattcgggcgaccac
gtcaaggccaaccaggccattgcagagatcgaggtcatgaagatgtacttgcctctcgtt
gccgccgaggacggcgtcgtctcgtttgtcaagaccgccggtgttgctctcagccctgga
gacattatcggtattctctcgcttgatgaccctagccgtgtccagcacgctaaacccttt
gctggccagctgcccgactttggaatgcccgtcatcgttggcaacaagcctcaccagcgt
tacacggcccttgtcgaggtactcaacgatatcctcgatggttacgaccagagcttccgc
atgcaggcggtcatcaaggagctcatcgagacgctccgcaaccccgagctgccctacggt
caggcctcccagattctgtccagcttgggcggccgtatccctgccaggctcgaggatgtg
gtgcgcaacacaattgagatgggccactcgaagaacattgagttccccgctgctcgtctg
cgcaagctcaccgagaacttcctccgtgacagcgtcgaccctgctatccgcggacaggtg
caaatcaccattgctcctctctaccagctcttcgagacctacgctggcggcctcaaggct
catgagggcaacgtgcttgcttcgttcctccaaaagtactacgaagttgagtcccagttt
accggtgaggctgacgtcgttctcgagcttcgtctccaggccgacggcgacctcgacaag
gttgtggccctgcagacttcgcgcaatggcatcaaccgcaaaaacgctctgctgctcacc
ttgcttgacaagcacatcaagggcacctcgcttgtctcgcgtactagcggtgctaccatg
atcgaggctctgcgcaagcttgcctcgcttcagggcaagtcgactgcccccatcgccctc
aaggctcgtgaggtctcgctcgacgccgacatgcccagtcttgccgaccgatcagctcag
atgcaggccattcttcgtggctccgtcacctcgtccaagtatggtggtgatgatgagtac
catgctccctcgcttgaggttctccgcgagctcagcgactcacagtacagcgtgtacgat
gtgctgcacagcttcttcggtcaccgcgagcaccatgtcgcctttgccgcgctctgcacc
tacgtcgtccgcgcctaccgagcttacgagattgtcaacttcgactatgccgttgaggac
tttgacgtcgaagaacgcgctgtgctcacctggcagttccagctgcctcgaagcgcttct
tcgctcaaggagcgtgagcgtcaggtgtctatcagcgacctcagcatgatggataacaac
aggagggctcgccccatccgcgagctgcgcactggtgccatgaccagctgcgccgatgtg
gccgacattcctgaacttctccctaaggttctcaagttcttcaagtcttctgccggtgcc
agtggagcgcccatcaatgtgctaaacgttgctgttgtcgaccagactgactttgtcgac
gccgaagtgcgaagccagcttgccctgtacaccaatgcctgcagcaaggagttttccgct
gctcgtgtccgccgtgtcacctacctcctttgccagcccggcttgtatcccttcttcgcc
accttccgtcccaacgagcagggcatctggtccgaagagaaggcgattcgcaacatcgaa
cccgcgcttgcctaccagcttgagctcgacagggtcagcaagaactttgagctcaccccc
gttccggtctcgtcgtccacgatccatctctactttgctcgtggtatccagaactcggcc
gatacccgattctttgttcgctcactcgtccgtcccggccgcgtgcagggcgacatggct
gcatacctcatctccgaatcggaccgcattgtcaacgatattctcaacgtcatcgaggta
gctcttggccagcccgagtaccgcaccgccgatgcttcgcacatcttcatgtctttcatc
taccagctggatgtcagcctcgtggatgtgcagaaggctattgccggcttccttgagcga
cacggcacccgcttcttccgtctccgcatcacaggtgccgagatccgcatgattctaaac
ggtcccaacggcgagccccgcccgatccgagcctttgtcaccaacgagaccggtctggtc
gtccgatacgagacatacgaggagactgtcgccgatgacggctctgtgattctgcgcggc
atcgagccccagggcaaggatgccacgctcaatgcccagagcgcacacttcccttacaca
accaaggtggcactgcagtcgcgacgatctcgtgcccacgctttgcagaccaccttcgtc
tacgactttatcgatgtgcttggtcaggccgtgcgtgcgtcgtggagaaaggttgctgcc
agcaagattcccggtgatgtcatcaagtcggccgtcgagttggtctttgacgagcaggag
aacctgcgtgaggtcaagcgtgctcctggtatgaacaacatcggcatggttgcttggctc
gtcgaggtgctcacccccgagtaccccgctggccgtaagctcgttgtcatcgggaacgac
gtcaccatccaggctggctcgttcggccccgttgaggaccgcttcttcgctgctgcctcc
aagctcgcccgtgagcttggtgtgccgcgcctctacatctcggccaattcgggtgcccgt
atcggcttggcaactgaggcgctcgacctgttcaaggtcaagttcgtcggcgacgaccct
gccaagggtttcgagtacatctacctcgacgacgagtcgctccaagccgtccaggccaag
gcgcccaacagtgtcatgaccaagcccgtccaggccgctgatggcagcgtccataacatc
atcaccgatatcatcggcaagcctcaggggggtctcggtgtcgagtgtctgtcgggcagt
ggtctcattgccggtgagaccagccgtgcaaaggaccagatcttcactgccaccatcatc
acgggacgaagtgtcggtatcggtgcctatcttgctcgtctgggcgagcgtgtaatccag
gtcgagggctcgcccttgatcctcactggttatcaggcactcaacaagctgctgggtcgt
gaggtctatacctcgaacctacagctcggtggtcctcagatcatgtacaagaacggtgtt
tctcacctcactgctcaggacgacctcgacgctgtcaggtcgtttgtcaactggatatca
tacgttcctgctcagcgtggtggacctctgccgatcatgcccaccaccgatagctgggac
cgagcggtcacataccagcctcctcgtggtccttacgacccacgatggctcatcaacggt
accaaggccgaagacggcaccaagctcaccggtcttttcgatgaaggctcatttgtcgag
acgcttggcggctgggccacttcggtagtcactggtcgtgctcgcctgggcggcatccct
gtcggtgtgatcgctgtcgagacgcgcacgctcgagcgtgttgttccggccgaccctgcg
aaccccaactcgaccgagcagcgcatcatggaagccggccaggtgtggtaccccaactca
gcgtacaagactgcccaagccatctgggactttgacaaagagggtctgcctttggtcatc
cttgccaactggcgtggattttcgggtggccagcaggacatgtacgacgagatcctcaag
cagggctccaagatcgtcgacggtctgtcgtcgtacaagcagcccgtgtttgttcacatt
ccacctatgggtgagcttcgcggtggttcgtgggtcgtggtcgactctgcgatcaacgac
aacggtatgatcgagatgtcggccgatgtcaacagcgcacgaggtggtgtgctggaagcc
tcaggtctggtcgagatcaagtaccgtgccgacaagcaacgtgctaccatggagcgactc
gacagcgtctatgccaagttgagcaaggaagctgccgaagcgaccgacttcaccgcgcag
accaccgctcgtaaggcgttggcagagcgagagaagcagctcgcacctatctttacggcg
atcgctaccgagtatgcagatgcacacgaccgtgcaggacgcatgcttgcgactggagtg
ctgcgatcggcgctgccatgggagaacgcgcgtcgatacttctactggcgtctcaggaga
aggttgaccgaggtcgctgctgaacgcacggttggcgaggccaacccgacgctgaagcat
gttgagaggctggctgtattgcgacagtttgttggtgctgctgcgagcgatgacgacaag
gcggtggctgagcacttggaggcttcggccgaccagctgttggccgcatccaaacagttg
aaggcacagtacatcttggctcagatctcgacattggaccctgaactgcgcgctcaacta
gccgcttcgctcaagtaa

DBGET integrated database retrieval system