KEGG   Ustilago maydis: UM04629.1Help
Entry
UM04629.1         CDS       T01021                                 

Definition
similar to S60200 acetyl-CoA carboxylase (EC 6.4.1.2) - smut fungus (Ustilago maydis)
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
uma  Ustilago maydis
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:uma00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    UM04629.1
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    UM04629.1
   00640 Propanoate metabolism
    UM04629.1
  Lipid metabolism
   00061 Fatty acid biosynthesis
    UM04629.1
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    UM04629.1
Enzymes [BR:uma01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     UM04629.1
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     UM04629.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
13
AA seq 2185 aa AA seqDB search
MPPPDHKAVSQFIGGNPLETAPASPVADFIRKQGGHSVITKVLICNNGIAAVKEIRSIRK
WAYETFGDERAIEFTVMATPEDLKVNADYIRMADQYVEVPGGSNNNNYANVDLIVDVAER
AGVHAVWAGWGHASENPRLPESLAASKHKIIFIGPPGSAMRSLGDKISSTIVAQHADVPC
MPWSGTGIKETMMSDQGFLTVSDDVYQQACIHTAEEGLEKAEKIGYPVMIKASEGGGGKG
IRKCTNGEEFKQLYNAVLGEVPGSPVFVMKLAGQARHLEVQLLADQYGNAISIFGRDCSV
QRRHQKIIEEAPVTIAPEDARESMEKAAVRLAKLVGYVSAGTVEWLYSPESGEFAFLELN
PRLQVEHPTTEMVSGVNIPAAQLQVAMGIPLYSIRDIRTLYGMDPRGNEVIDFDFSSPES
FKTQRKPQPQGHVVACRITAENPDTGFKPGMGALTELNFRSSTSTWGYFSVGTSGALHEY
ADSQFGHIFAYGADRSEARKQMVISLKELSIRGDFRTTVEYLIKLLETDAFESNKITTGW
LDGLIQDRLTAERPPADLAVICGAAVKAHLLARECEDEYKRILNRGQVPPRDTIKTVFSI
DFIYENVKYNFTATRSSVSGWVLYLNGGRTLVQLRPLTDGGLLIGLSGKSHPVYWREEVG
MTRLMIDSKTCLIEQENDPTQIRSPSPGKLVRFLVDSGDHVKANQAIAEIEVMKMYLPLV
AAEDGVVSFVKTAGVALSPGDIIGILSLDDPSRVQHAKPFAGQLPDFGMPVIVGNKPHQR
YTALVEVLNDILDGYDQSFRMQAVIKELIETLRNPELPYGQASQILSSLGGRIPARLEDV
VRNTIEMGHSKNIEFPAARLRKLTENFLRDSVDPAIRGQVQITIAPLYQLFETYAGGLKA
HEGNVLASFLQKYYEVESQFTGEADVVLELRLQADGDLDKVVALQTSRNGINRKNALLLT
LLDKHIKGTSLVSRTSGATMIEALRKLASLQGKSTAPIALKAREVSLDADMPSLADRSAQ
MQAILRGSVTSSKYGGDDEYHAPSLEVLRELSDSQYSVYDVLHSFFGHREHHVAFAALCT
YVVRAYRAYEIVNFDYAVEDFDVEERAVLTWQFQLPRSASSLKERERQVSISDLSMMDNN
RRARPIRELRTGAMTSCADVADIPELLPKVLKFFKSSAGASGAPINVLNVAVVDQTDFVD
AEVRSQLALYTNACSKEFSAARVRRVTYLLCQPGLYPFFATFRPNEQGIWSEEKAIRNIE
PALAYQLELDRVSKNFELTPVPVSSSTIHLYFARGIQNSADTRFFVRSLVRPGRVQGDMA
AYLISESDRIVNDILNVIEVALGQPEYRTADASHIFMSFIYQLDVSLVDVQKAIAGFLER
HGTRFFRLRITGAEIRMILNGPNGEPRPIRAFVTNETGLVVRYETYEETVADDGSVILRG
IEPQGKDATLNAQSAHFPYTTKVALQSRRSRAHALQTTFVYDFIDVLGQAVRASWRKVAA
SKIPGDVIKSAVELVFDEQENLREVKRAPGMNNIGMVAWLVEVLTPEYPAGRKLVVIGND
VTIQAGSFGPVEDRFFAAASKLARELGVPRLYISANSGARIGLATEALDLFKVKFVGDDP
AKGFEYIYLDDESLQAVQAKAPNSVMTKPVQAADGSVHNIITDIIGKPQGGLGVECLSGS
GLIAGETSRAKDQIFTATIITGRSVGIGAYLARLGERVIQVEGSPLILTGYQALNKLLGR
EVYTSNLQLGGPQIMYKNGVSHLTAQDDLDAVRSFVNWISYVPAQRGGPLPIMPTTDSWD
RAVTYQPPRGPYDPRWLINGTKAEDGTKLTGLFDEGSFVETLGGWATSVVTGRARLGGIP
VGVIAVETRTLERVVPADPANPNSTEQRIMEAGQVWYPNSAYKTAQAIWDFDKEGLPLVI
LANWRGFSGGQQDMYDEILKQGSKIVDGLSSYKQPVFVHIPPMGELRGGSWVVVDSAIND
NGMIEMSADVNSARGGVLEASGLVEIKYRADKQRATMERLDSVYAKLSKEAAEATDFTAQ
TTARKALAEREKQLAPIFTAIATEYADAHDRAGRMLATGVLRSALPWENARRYFYWRLRR
RLTEVAAERTVGEANPTLKHVERLAVLRQFVGAAASDDDKAVAEHLEASADQLLAASKQL
KAQYILAQISTLDPELRAQLAASLK
NT seq 6558 nt NT seq  +upstreamnt  +downstreamnt
atgccgcctccggatcacaaggcagtcagccagtttatcggcggcaacccgcttgaaacc
gctcccgccagccctgttgccgactttattcgcaaacagggtggtcacagtgtcatcacc
aaggtcctcatttgcaacaacggtatcgccgccgtcaaggagattcgctccatccgaaaa
tgggcctacgagacctttggcgatgagcgtgccattgaatttaccgtcatggccacccct
gaggacctcaaagtcaatgccgactacatccgcatggccgaccaatacgtcgaggtaccc
ggtggctctaacaacaacaactacgctaacgtcgacctcatcgtcgatgtcgctgagcga
gccggcgttcacgccgtatgggctggctggggtcacgcctccgagaacccacgcctacct
gaatcgctcgccgcctccaagcacaagatcatctttatcggtccccccggctccgccatg
cgctcgcttggtgacaagatctcgtccaccatcgtcgcacagcacgccgacgtgccatgc
atgccctggtccggtaccggcatcaaggagaccatgatgagcgatcagggtttcctgacc
gtctcggacgacgtctaccaacaggcctgcatccacaccgctgaagaaggtcttgagaag
gccgaaaagatcggctaccccgtcatgatcaaggcctccgaaggtggaggaggaaagggt
atccgaaagtgtaccaacggcgaagaattcaagcagctctacaacgccgttctcggtgaa
gtgcccggctcgcccgttttcgttatgaaactcgccggccaggcgcgtcatctcgaggtg
cagctgctggccgatcagtacggcaacgccatcagcatctttggtcgtgactgctctgtc
cagcgtcgtcaccaaaagatcatcgaggaggctcctgtcactatcgctcctgaggatgcc
cgcgagtccatggagaaggctgccgtgcgtctcgccaaactggtcggctacgtctctgcc
ggtaccgtcgaatggctctactctcccgagtcgggcgagtttgccttcctcgagctcaac
ccccgtcttcaggtcgagcaccctactaccgagatggtctcgggtgtcaacattcccgct
gcccagcttcaggtcgccatgggtatccctctctactcgatccgcgacatccgaaccctt
tacggcatggaccctcgcggtaatgaggtcatcgactttgacttctctagccccgagtcg
ttcaagacccagcgcaagcctcagccccagggccacgtagtcgcctgccgtatcactgcc
gaaaaccccgacaccggcttcaagcctggcatgggtgccctcactgagctcaacttccgc
tccagcacctccacctggggttacttctccgtcggcaccagcggtgctctccacgagtac
gccgattcgcagttcggacacatctttgcctatggtgccgaccgatccgaggcgcgaaaa
cagatggtcatctcgctcaaggagctctccattcgcggtgacttccgtaccaccgtcgaa
tacctcatcaagttgctcgagaccgacgccttcgagtccaacaagatcaccactggatgg
ctcgatggtctcattcaggaccgtctcactgccgaacgacctcctgcggacctcgctgtc
atttgcggtgctgccgtcaaggctcatctccttgcgcgtgagtgcgaggacgagtacaag
cgcatcttgaatagaggtcaggtccctcctcgcgacaccatcaagaccgtcttctcgatc
gacttcatctacgagaacgtcaagtacaactttactgccacgcgcagctccgtctccggc
tgggtcctctacctcaacggtggacgtacgctggtgcagctccgaccccttaccgacgga
ggtctgctcattggtctttcgggcaagtcgcaccccgtctactggcgtgaggaggtcggc
atgacccgtctcatgatcgactccaagacctgcctcatcgagcaggagaatgaccccacc
cagatccgctcgccctcgcccggtaagctcgttcgcttcttggtggattcgggcgaccac
gtcaaggccaaccaggccattgcagagatcgaggtcatgaagatgtacttgcctctcgtt
gccgccgaggacggcgtcgtctcgtttgtcaagaccgccggtgttgctctcagccctgga
gacattatcggtattctctcgcttgatgaccctagccgtgtccagcacgctaaacccttt
gctggccagctgcccgactttggaatgcccgtcatcgttggcaacaagcctcaccagcgt
tacacggcccttgtcgaggtactcaacgatatcctcgatggttacgaccagagcttccgc
atgcaggcggtcatcaaggagctcatcgagacgctccgcaaccccgagctgccctacggt
caggcctcccagattctgtccagcttgggcggccgtatccctgccaggctcgaggatgtg
gtgcgcaacacaattgagatgggccactcgaagaacattgagttccccgctgctcgtctg
cgcaagctcaccgagaacttcctccgtgacagcgtcgaccctgctatccgcggacaggtg
caaatcaccattgctcctctctaccagctcttcgagacctacgctggcggcctcaaggct
catgagggcaacgtgcttgcttcgttcctccaaaagtactacgaagttgagtcccagttt
accggtgaggctgacgtcgttctcgagcttcgtctccaggccgacggcgacctcgacaag
gttgtggccctgcagacttcgcgcaatggcatcaaccgcaaaaacgctctgctgctcacc
ttgcttgacaagcacatcaagggcacctcgcttgtctcgcgtactagcggtgctaccatg
atcgaggctctgcgcaagcttgcctcgcttcagggcaagtcgactgcccccatcgccctc
aaggctcgtgaggtctcgctcgacgccgacatgcccagtcttgccgaccgatcagctcag
atgcaggccattcttcgtggctccgtcacctcgtccaagtatggtggtgatgatgagtac
catgctccctcgcttgaggttctccgcgagctcagcgactcacagtacagcgtgtacgat
gtgctgcacagcttcttcggtcaccgcgagcaccatgtcgcctttgccgcgctctgcacc
tacgtcgtccgcgcctaccgagcttacgagattgtcaacttcgactatgccgttgaggac
tttgacgtcgaagaacgcgctgtgctcacctggcagttccagctgcctcgaagcgcttct
tcgctcaaggagcgtgagcgtcaggtgtctatcagcgacctcagcatgatggataacaac
aggagggctcgccccatccgcgagctgcgcactggtgccatgaccagctgcgccgatgtg
gccgacattcctgaacttctccctaaggttctcaagttcttcaagtcttctgccggtgcc
agtggagcgcccatcaatgtgctaaacgttgctgttgtcgaccagactgactttgtcgac
gccgaagtgcgaagccagcttgccctgtacaccaatgcctgcagcaaggagttttccgct
gctcgtgtccgccgtgtcacctacctcctttgccagcccggcttgtatcccttcttcgcc
accttccgtcccaacgagcagggcatctggtccgaagagaaggcgattcgcaacatcgaa
cccgcgcttgcctaccagcttgagctcgacagggtcagcaagaactttgagctcaccccc
gttccggtctcgtcgtccacgatccatctctactttgctcgtggtatccagaactcggcc
gatacccgattctttgttcgctcactcgtccgtcccggccgcgtgcagggcgacatggct
gcatacctcatctccgaatcggaccgcattgtcaacgatattctcaacgtcatcgaggta
gctcttggccagcccgagtaccgcaccgccgatgcttcgcacatcttcatgtctttcatc
taccagctggatgtcagcctcgtggatgtgcagaaggctattgccggcttccttgagcga
cacggcacccgcttcttccgtctccgcatcacaggtgccgagatccgcatgattctaaac
ggtcccaacggcgagccccgcccgatccgagcctttgtcaccaacgagaccggtctggtc
gtccgatacgagacatacgaggagactgtcgccgatgacggctctgtgattctgcgcggc
atcgagccccagggcaaggatgccacgctcaatgcccagagcgcacacttcccttacaca
accaaggtggcactgcagtcgcgacgatctcgtgcccacgctttgcagaccaccttcgtc
tacgactttatcgatgtgcttggtcaggccgtgcgtgcgtcgtggagaaaggttgctgcc
agcaagattcccggtgatgtcatcaagtcggccgtcgagttggtctttgacgagcaggag
aacctgcgtgaggtcaagcgtgctcctggtatgaacaacatcggcatggttgcttggctc
gtcgaggtgctcacccccgagtaccccgctggccgtaagctcgttgtcatcgggaacgac
gtcaccatccaggctggctcgttcggccccgttgaggaccgcttcttcgctgctgcctcc
aagctcgcccgtgagcttggtgtgccgcgcctctacatctcggccaattcgggtgcccgt
atcggcttggcaactgaggcgctcgacctgttcaaggtcaagttcgtcggcgacgaccct
gccaagggtttcgagtacatctacctcgacgacgagtcgctccaagccgtccaggccaag
gcgcccaacagtgtcatgaccaagcccgtccaggccgctgatggcagcgtccataacatc
atcaccgatatcatcggcaagcctcaggggggtctcggtgtcgagtgtctgtcgggcagt
ggtctcattgccggtgagaccagccgtgcaaaggaccagatcttcactgccaccatcatc
acgggacgaagtgtcggtatcggtgcctatcttgctcgtctgggcgagcgtgtaatccag
gtcgagggctcgcccttgatcctcactggttatcaggcactcaacaagctgctgggtcgt
gaggtctatacctcgaacctacagctcggtggtcctcagatcatgtacaagaacggtgtt
tctcacctcactgctcaggacgacctcgacgctgtcaggtcgtttgtcaactggatatca
tacgttcctgctcagcgtggtggacctctgccgatcatgcccaccaccgatagctgggac
cgagcggtcacataccagcctcctcgtggtccttacgacccacgatggctcatcaacggt
accaaggccgaagacggcaccaagctcaccggtcttttcgatgaaggctcatttgtcgag
acgcttggcggctgggccacttcggtagtcactggtcgtgctcgcctgggcggcatccct
gtcggtgtgatcgctgtcgagacgcgcacgctcgagcgtgttgttccggccgaccctgcg
aaccccaactcgaccgagcagcgcatcatggaagccggccaggtgtggtaccccaactca
gcgtacaagactgcccaagccatctgggactttgacaaagagggtctgcctttggtcatc
cttgccaactggcgtggattttcgggtggccagcaggacatgtacgacgagatcctcaag
cagggctccaagatcgtcgacggtctgtcgtcgtacaagcagcccgtgtttgttcacatt
ccacctatgggtgagcttcgcggtggttcgtgggtcgtggtcgactctgcgatcaacgac
aacggtatgatcgagatgtcggccgatgtcaacagcgcacgaggtggtgtgctggaagcc
tcaggtctggtcgagatcaagtaccgtgccgacaagcaacgtgctaccatggagcgactc
gacagcgtctatgccaagttgagcaaggaagctgccgaagcgaccgacttcaccgcgcag
accaccgctcgtaaggcgttggcagagcgagagaagcagctcgcacctatctttacggcg
atcgctaccgagtatgcagatgcacacgaccgtgcaggacgcatgcttgcgactggagtg
ctgcgatcggcgctgccatgggagaacgcgcgtcgatacttctactggcgtctcaggaga
aggttgaccgaggtcgctgctgaacgcacggttggcgaggccaacccgacgctgaagcat
gttgagaggctggctgtattgcgacagtttgttggtgctgctgcgagcgatgacgacaag
gcggtggctgagcacttggaggcttcggccgaccagctgttggccgcatccaaacagttg
aaggcacagtacatcttggctcagatctcgacattggaccctgaactgcgcgctcaacta
gccgcttcgctcaagtaa

DBGET integrated database retrieval system