KEGG   Ustilago maydis: UM04659.1Help
Entry
UM04659.1         CDS       T01021                                 

Definition
hypothetical protein
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
uma  Ustilago maydis
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:uma00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    UM04659.1
Enzymes [BR:uma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     UM04659.1
Exosome [BR:uma04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   UM04659.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
13
AA seq 510 aa AA seqDB search
MPDLVGSIDAGTTSVRFMVFDEFAKVHASHQMEFNQYYPHPGWHEQDAHEIIDCVYECID
KALAKLEEGGKFKTSDVKVIGVTNQRETTVVWDKNTGKALTRAIAWPDARTTSTIRKLES
QHPKGIDAVKEETGLPLSTYFASVKLRWMLDNLPEVRKAHDDKQMLFGTVDSWIVYNLTD
KQVHITDASNASRTMFMDLRAQTWDQKLCDFFGIDMDILPEIKSSSEVYGKVSHGALNGV
EIAGIVGDQMAALVGNKCFQPGEAKNTYGTGAFLLYNTGEKVVSSKNGLLSTIAYKAGPH
APVHYALEGSIAVAGSAVKWVRDSLGLIKEASEIGELAGQVQDTGGVYFVTAFNGLFCPY
WDDTAAGTVVGITAYTDKRHFCRATLESTCYQTKAILDAMSKDSGVALKALQVDGGLTNS
DVAMQIQADILGINVERPEMRESTALGSALLAGSAVGLFGWDINKPETLSKVNTAGKQVF
EPKIDQEKRAKLLHGWERAVERAKGWNENA
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgccggatctcgtgggttcgattgacgctggcaccaccagcgtccgattcatggtattt
gacgaattcgccaaagtgcatgcttcgcaccagatggagttcaaccagtactacccgcat
ccaggatggcacgagcaggacgcacacgaaatcatcgactgcgtgtacgaatgcatcgac
aaggcgctcgccaagctcgaagagggcggcaagtttaaaacatccgatgtcaaggtcatc
ggtgtcaccaatcagcgagagacgaccgtggtttgggacaagaacaccggcaaggcgttg
acacgcgccatcgcctggcccgacgcacgaaccacttccaccatccgaaaactcgaatcc
cagcatccaaaggggattgatgctgtcaaggaagagaccggattgccgctctcgacctat
ttcgcttcagtcaaacttcgttggatgctcgacaacctacccgaggtgcgcaaggcgcac
gacgacaagcagatgctcttcggcaccgtagacagttggatcgtgtacaatctcaccgac
aaacaggtgcacattaccgatgcttccaatgcttcgcgaaccatgttcatggacctgcgc
gcacagacgtgggaccagaagctgtgcgatttctttggtatcgacatggacatcctgccc
gagatcaagagttcatccgaggtgtacggcaaggtttcgcatggtgcgctcaacggcgtc
gagatcgccggtatcgtaggagaccagatggctgcgttggtgggcaacaagtgttttcag
cctggtgaggccaagaacacgtacggaacgggtgcgtttctgctctacaatacgggtgaa
aaagtggtctcgtccaagaacggtttgctctccaccatcgcatacaaggcaggtccgcat
gcaccggtgcactatgccttggaaggctccatcgctgtagctggttcggcagtcaagtgg
gttcgcgacagccttgggctgatcaaggaggccagcgagatcggcgagctggcaggccaa
gtccaagacacgggaggtgtctattttgtcacggcattcaacggactcttctgcccgtac
tgggacgacaccgcggccggcaccgtggtgggcatcactgcctacacggacaaacgacac
ttctgccgtgccacgctggaatcgacgtgctaccagacaaaagccatcctggacgcaatg
tccaaagactcgggagtcgcactcaaggctctccaagtcgatggtggactgactaactcg
gacgtagccatgcagatccaagctgacatcctgggcatcaacgtggagcgtcccgagatg
cgcgaaagtacagcgctcggttcggcgctgcttgccggatcggcggtgggattattcgga
tgggacatcaacaagccagagacactcagcaaggtcaacacggcgggtaagcaggtgttc
gaacccaaaatcgatcaagagaagcgcgccaagctgctacacggctgggagagggccgtg
gaacgcgccaagggctggaacgagaacgcttga

DBGET integrated database retrieval system