KEGG   Ustilago maydis: UM04864.1Help
Entry
UM04864.1         CDS       T01021                                 

Definition
hypothetical protein
Orthology
K08294  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
uma  Ustilago maydis
Pathway
MAPK signaling pathway - yeast
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway - yeast [PATH:uma04011]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
17
AA seq 822 aa AA seqDB search
MFTVVGLQVRRHAPSHPHAPYAADSWPLAARRRAPIVTRGDLTLMTCPHAHVTQAVSEAR
VHESTLGHVVQTCCCEYCIRDFNGTLAAGQTERVSDRSLRTAPPACWSFAISPVAQLLGY
YPPSAQPLSQHWHHKRSHSKHSSFATMASLIPPKKPRKPGMPKLTIPTRPTSSSSAPSGS
LACDDAPFDAASAAKAQPGHPSQRPQPSLIIPQHSTSSLSLGGHAYQDEGYEDGHPGVFN
TTASTIYPDTVPHLTNSQMYTAITDDLRRAIGGMSITDSDGERLDASGLRIPVTGGKSSS
HGYWMTNDSATASINADGTEPNGADVSSQPSQSRTRTDSSASAASTRASNQGGHDDELVL
AGNFEMLSRLGEGASGEVHKVRHRPTGLIMAKKTISTSPNPAIHRQILRELAFNRSCHSD
YIVRYYGAFLEEQDTSIAICMEYAEAGSLDAIYKKVKSRNGRTGEKVLGKVAECVLKGLS
YLHERKIIHRDIKPSNIVVTRQGQIKLCDFGVSGELINSVAGTFTGTSFYMAPERIRGLA
YTITSDVWSLGLTILEVASNRFPFPAEGEPPLGPIDLLSYVVNMKVPELQDDEKAGVKWS
RALRDFIERCLEKEPTKRPGPHKMISHPFIRKSETRQPQPDIAKFVADVYGWSYLPSSIA
NQQEQTPTQATTKSATLGRIPSVRSAPVATAALTAMTNDQPIPVPIPTSVTATATATATQ
FGAPPCIAPATQASRSIGAPSDRLRTLPKISVTIDEQARTEPTNEPPEESAGTQAASFGI
RPRSHSQARSQEERLAARLREADIGLVGSPTTTTDEDEAGRA
NT seq 2469 nt NT seq  +upstreamnt  +downstreamnt
atgttcacggttgttggtttgcaggtacgcaggcacgcaccatcgcatccgcatgccccg
tacgccgctgactcgtggccgcttgccgcacgccggcgcgctcctattgtcactcgcggc
gaccttacactcatgacttgtccccacgctcacgtcacccaagccgtgagcgaagctcga
gttcacgagtccacgctgggtcatgttgttcaaacgtgttgttgtgagtactgcattcgt
gacttcaacggtaccctcgccgctggacagacagagcgggtctctgataggtctcttcga
acggcaccgcctgcttgttggtcgtttgcaatttcgccagttgctcaactgctcgggtac
tatcctccatcggctcaacctttgtcacagcactggcatcacaagcgctcgcatagcaaa
cacagcagcttcgctaccatggcctcgctcattccaccgaagaaaccgcgcaagccgggc
atgcccaagctcaccatcccaacaagacccacttcctcttcttcggctcccagcggctca
cttgcatgcgatgacgctccttttgatgctgcttctgcggcaaaggctcagccaggtcac
ccatctcagcgaccacaaccttcattgataattccacagcattccacatcctcattatct
ctcggaggtcacgcataccaggatgagggctacgaggacggccatcccggcgtcttcaat
accacggcttccaccatctacccagacacggttccgcatctcaccaactctcagatgtac
actgcaatcacagatgacctacggcgtgctatcggaggcatgtccatcaccgactcggat
ggtgagcgcctggatgccagcgggctcaggatcccagtcacaggcggcaaatcttcgtct
cacggctactggatgacgaatgactcggcgaccgcgagtatcaacgcagacggcacagaa
ccaaatggcgcagacgtatcgtcgcagccatctcagtctcgaacaaggaccgactcgagc
gcttcagcagcatcgacacgagcgagcaaccaaggtggacatgacgatgaactcgtcttg
gcaggcaactttgagatgctctctcgacttggagaaggcgccagcggtgaagtgcacaag
gttcgccatcgccctacaggtctcatcatggccaaaaagaccatatccacttctcccaac
ccagcaatccaccgacagattctgcgtgagcttgctttcaaccgctcctgtcattcggac
tacatcgtacgatactatggagcttttctcgaggaacaagatacctcgattgccatctgt
atggaatatgcagaagctggctcgctagatgccatctacaagaaagtcaagagccgcaat
ggccgaacgggagaaaaggtactcggcaaggtggccgagtgtgttctcaagggattgagc
tacctgcacgaacgcaagatcatccatcgtgatattaagcccagcaacatcgtcgtcacg
cgccaaggtcagatcaaattgtgcgatttcggtgtgtctggcgagctgatcaactcggtt
gccggtacttttacgggcacaagcttctacatggcgcccgagaggatccgaggcttggcg
tataccatcacttccgacgtttggtcgcttggcctcactatcctggaagtggcaagcaat
cggttccccttccctgctgaaggtgagccgccgctgggaccaatcgatctgctctcgtac
gtggtcaacatgaaggtgcccgagctgcaggatgatgagaaggctggcgtcaaatggtcc
agagctctgcgtgactttatcgagcgttgcctcgaaaaggagcctaccaagcgacccggt
ccccacaagatgatcagtcatcctttcatccgcaaatccgagacgcgacagccgcagccc
gacattgccaaatttgttgcagacgtctacggttggagctatctgccgagttcgatcgcc
aaccaacaggaacagacgcccacgcaggcgacaactaagagcgcaacattgggcaggatc
ccaagcgtgcgttctgcgcctgtcgcaacagccgctttgactgctatgacgaatgatcaa
ccgatcccggtacccataccgacatcggtgacggcgacggcaacagcgacagcgacacag
ttcggtgctccgccatgtatcgcaccagcaacacaggcttctagatcgataggagcaccg
agtgacagactacgtacacttcccaagatctcggtaacaatcgacgagcaagcccgcaca
gagccgaccaacgaaccgccagaggagtcagctggtacgcaagctgcttcctttggcata
aggccacgatcgcatagccaggctcgaagtcaagaggagcgactagcagctagactgcga
gaggctgatattgggctggtgggtagccctacgacaaccacagatgaggatgaagctgga
cgcgcctag

DBGET integrated database retrieval system