KEGG   Ustilago maydis: UM04908.1Help
Entry
UM04908.1         CDS       T01021                                 

Definition
hypothetical protein
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
uma  Ustilago maydis
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:uma00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    UM04908.1
Translation factors [BR:uma03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    UM04908.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
15
AA seq 253 aa AA seqDB search
MSDWENDDEPQQPVAPPKLSAAGRKKFDDEDVEDEVKDDWEEEDSEPEAAKTPVVLPPRK
KKSVKQKIAEKEEEERLRREQGLDTDEEEEEEEDWDADPIAKRRMEREAQLKSDVENAAN
LLGTAKLSDDELSSLKTANPSSKEDWEKLSTSIFTELIKKHASKPGFEKHFVPHFYKTLA
STMRDVDIRKASTMLKTYAEEKVKAEKEAKKAGGQKTKLAAAKPKMVGTSSAKNVIDTNV
YGDEALDDDLDFM
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagcgactgggaaaacgacgacgagccgcaacagccggttgccccgcccaagctctcg
gctgctggtcgaaagaagttcgacgacgaagacgttgaagacgaagttaaggacgactgg
gaagaagaggattcggagcccgaagcagctaagacacccgttgttctgccaccacgtaag
aaaaaaagtgtcaagcagaagattgccgaaaaggaggaagaagaacgattgcgacgcgag
cagggcctggacacggacgaggaggaggaggaagaagaagattgggatgccgatccgata
gccaaacgtcgtatggaacgagaggctcagctgaagagcgatgttgagaacgctgctaac
cttcttggtactgccaagctgtcggacgatgaactctcatcactgaagacagcgaaccca
tcatcgaaagaagattgggaaaagctttccacttcgattttcactgaactcatcaagaag
catgcgagcaaaccgggattcgaaaagcactttgtgccgcacttttacaaaaccctcgca
tccactatgcgcgatgtcgacattcgcaaggcatcgaccatgctcaagacgtacgccgag
gagaaggtgaaagccgaaaaggaagccaagaaagcgggtggtcagaagaccaaacttgca
gccgccaagcccaagatggtgggaacgagcagcgccaaaaatgtcatcgacaccaacgta
tatggcgatgaagcgctggatgacgacttggacttcatgtaa

DBGET integrated database retrieval system