KEGG   Ustilago maydis: UM04939.1Help
Entry
UM04939.1         CDS       T01021                                 

Definition
hypothetical protein
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
uma  Ustilago maydis
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:uma01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:uma00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
15
AA seq 322 aa AA seqDB search
MTKTLHERFLQEKTVAIVGCPFSGGQRRKGVDTGPVSLVQAGICQQLESLGWKVDFTDHH
SFDHINQGIDSDTDIGNMKLPRTVSAVTKEVAEVVESHAKQGKLPLTLGGDHSLALGTVS
GSLRAHPDAALIWIDAHADINTPETTESGNLHGCPVSFLLGLQGTDVEPFNSWVPSKPLL
RADSLVYIGLRDIDAGERKILKQNNIKAFSMHHVDKFGIGKVVEMALDHVNGAPGKRDRP
IHLSFDVDALDPSVAPSTGTPVRGGLTFREGHYICEALYETGCLVALDLMEVNPSLLQDR
EAQQTIAVGCSLIRSAMGETLL
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagacacttcacgaacgattccttcaagaaaagacggtagccatcgtcggctgc
cccttttcgggtggacagaggcgcaagggtgtcgacactggccccgtctctctggtgcag
gcgggcatctgccaacagctcgagtcgctcggctggaaggtcgactttaccgaccaccac
tcgtttgaccacatcaaccaaggcatcgacagtgacacggacattggcaatatgaaactg
cctcgcaccgtctcggcggtgaccaaggaggtagccgaggtggttgagtcgcacgccaag
cagggtaagctgccgctcacgctgggtggagaccacagtttggcgctcggcaccgtctct
ggatcgttgcgagcgcacccggacgcggcgcttatctggattgacgcgcacgccgacatc
aacacccccgaaaccaccgaatctggcaacctgcacggctgccctgtctcgttcttgctt
ggcttgcaaggaaccgacgtcgaacctttcaactcgtgggtgcctagcaagccactcctg
cgtgccgatagcttggtctacattggtctgcgtgatattgacgcaggcgagcgcaagatt
ctcaagcagaacaacatcaaggcgttcagcatgcatcacgtcgacaagtttggcatcgga
aaggtagtcgagatggcactcgaccatgtcaacggagcaccaggcaagcgagaccgaccg
atccacctctcgtttgacgttgacgcgctcgatcctagcgtcgctcctagcacaggcaca
ccggtccgaggcggtctcaccttccgcgagggtcattacatctgcgaggcgctatacgaa
actggatgcctggtcgctctggacctcatggaggtcaacccatccttgctccaagaccgc
gaagcacagcagacgatcgctgtcggctgctctctcattcgctctgccatgggcgagacg
cttctatga

DBGET integrated database retrieval system