KEGG   Ustilago maydis: UM04973.1Help
Entry
UM04973.1         CDS       T01021                                 

Definition
hypothetical protein
Orthology
K07511  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
uma  Ustilago maydis
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Fatty acid metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:uma00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    UM04973.1
   01212 Fatty acid metabolism
    UM04973.1
  Carbohydrate metabolism
   00640 Propanoate metabolism
    UM04973.1
   00650 Butanoate metabolism
    UM04973.1
  Lipid metabolism
   00062 Fatty acid elongation
    UM04973.1
   00071 Fatty acid degradation
    UM04973.1
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    UM04973.1
   00310 Lysine degradation
    UM04973.1
   00380 Tryptophan metabolism
    UM04973.1
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    UM04973.1
Enzymes [BR:uma01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     UM04973.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
15
AA seq 324 aa AA seqDB search
MEPMVLCSVKSEDLFRDTIIFPSRSSHKMLASTVRTALRTSAPRIAALPSTRCLSTSLPR
LSSATAKEYQNILVSSPAKGVTLITLNRPKALNALNSALFHELNEATEIADNDPEVGAIV
LTGSEKAFAAGADIKEMKDKQYADAYKTNFLGHWTKLTTVRKPIIAAVSGFALGGGCELA
MMCDIILASPTANFGQPEINLGVIPGAGGTQRLTKAVGKSTAMEMVLTGRNFSADDAERR
GLISRVVREGSVVDEAVKVASTIAKKGQIAVQAAKEGVNASFELSLQEGTRFERRLFQSL
FATKDQKEGMAAFAEKRKANFTHE
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggagccgatggtgctttgcagcgtgaagtcagaagatttgtttcgcgacaccatcatc
ttcccgtcccgtagctcgcacaagatgttggcctcaaccgttcgcaccgcgcttcgcacc
agcgcgccccgcatcgctgcgctcccctccacacgctgcctgtccacctcgctgccgcgt
ctttcgtcggcaactgccaaggaataccaaaacatcctcgtctcgtcgcccgccaaaggc
gttacgctgatcacgttgaaccgacctaaggcgctgaatgcactcaattcggcgctcttc
cacgaactcaacgaagccaccgagatcgccgacaatgaccctgaggtcggagctatcgtc
ctcaccggatccgaaaaggcgttcgctgcgggcgccgatatcaaggagatgaaggacaag
cagtacgctgatgcatacaagaccaacttcttgggtcactggaccaagctcaccacggtg
cgcaaaccgatcattgctgctgtgagcgggttcgcccttggtggtggttgcgagttggcc
atgatgtgcgatatcatcctcgcttcgcccacagccaactttggtcaacctgagatcaac
ctcggcgtcattcctggcgccggtggcacgcaacgtctcaccaaagctgttggaaaatcc
accgccatggagatggtactcacgggccgcaactttagcgccgatgacgccgagcgtcgc
ggcttgatctcgcgcgtcgttcgcgagggaagcgtcgttgatgaagccgtcaaggtcgct
tccaccattgccaaaaagggtcagatcgctgtccaggccgccaaggaaggtgtcaatgcc
tccttcgagctgagcttgcaagagggaactcgcttcgaacgccgtctcttccagagtcta
ttcgctaccaaagatcagaaagaaggcatggcggctttcgccgaaaaaaggaaggccaac
tttacgcacgagtaa

DBGET integrated database retrieval system