KEGG   Ustilago maydis: UM05151.1Help
Entry
UM05151.1         CDS       T01021                                 

Definition
hypothetical protein
Orthology
K06634  
cyclin H
Organism
uma  Ustilago maydis
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:uma03022]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:uma03420]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 493 aa AA seqDB search
MVVVKTEPSTVALAADAASASKSIHPAAGPSSYRAASMRPVEIVSTPSIPPPFGPSSAYA
QTSQARNWRFSHAELARIRASCNAAARARLQTIWAEETGSSCSATIPFLSVEDELALIAY
YLVKIGQIVHALKLPELVEATATTFVKRFYLRNTCMDFHPKNIVTTCIFLASKSENYALN
LADFARKLAGKQAAENKALVEENTRTVLDLEFLVSQSLAFEYAVTGAHRSLYGLLLDLQS
IQIGEDMSREELHKLAAEAHAKLAKTRLTDAEFVYTPSQIGLACIRAVEPKGKHIVAAWL
DSKQKTASSAALAAKRHRQAVREQESQRVARAKIAFARRTKGLPGAKAVEDQLAAESSAT
TQEVEFDDSLLHHQPLGMSRDQLEATLDQIEQLIHQREIGGYTGKGTGAQDLERIKQIDA
RQKLCMNPENVPGSKLFRKRRAQDDDDDADQVSTRRHGKRARGDDAKSIAMDSDDDDNVP
EAHALRAKPEPQV
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggtagtcgtaaagacagagccaagcacggtagctcttgctgctgatgccgcctctgcc
tccaaatccattcacccagccgctggcccttcgtcataccgagcagcttcgatgcggccc
gtcgagatcgtctcgacgccttccatcccaccgccgttcggaccatcctccgcctacgct
cagacgtctcaagcacgcaactggcgattcagccatgcagaactagcgcgcatccgcgct
tcctgcaacgctgctgcgcgagcacgtctgcaaaccatctgggccgaagagacgggctcc
tcttgctctgccaccatccctttcctctcggtcgaagacgagctggcactgatcgcctac
tacctcgtcaaaattggccagattgttcacgcgctcaaactccctgaactcgtcgaagct
accgcgaccacattcgtcaagcgcttctacctgcgcaacacatgcatggattttcacccc
aagaacatcgtcactacgtgcatcttcctcgcttccaagtcggaaaattacgcgctcaac
ctcgccgactttgcacgcaagcttgcaggcaaacaggccgccgagaacaaggcgctagtc
gaagagaacacgaggacggtgctcgatctagagtttctcgtgagccagagtctcgcgttc
gaatacgcggttaccggcgcacacaggagtctgtatggactgctcttggatctgcagtcc
atccagattggtgaagatatgtccagagaggagctgcacaagttagcagccgaagcacac
gccaagttggcaaagaccaggttgaccgatgcagagtttgtgtatacgccgtcgcagatc
ggcttggcttgcatacgagcagtagagcccaagggaaagcacatcgtagccgcctggctg
gacagtaagcagaaaacagccagcagtgctgcgcttgcagccaagaggcaccgccaagcc
gtgcgagagcaggaatcccaacgtgtcgccagggccaagatcgcttttgcccgacgaaca
aagggcttaccaggcgccaaagcggtcgaagaccaattggcagcagagtcaagtgctaca
acccaagaggtggaattcgacgattcgctcttgcaccatcagccattgggaatgtcgcgc
gatcaactcgaagccacactcgaccagatcgagcagctcattcaccagcgcgaaatcggc
ggttacacaggcaaaggaacaggcgcccaagatttggagcgcatcaaacagatcgatgca
agacaaaagctgtgtatgaatcccgaaaacgttcctggctcaaagctgttccgtaaacga
cgcgcacaagacgacgatgacgatgccgatcaagtgtcgacgcgtaggcatggaaagaga
gccagaggtgacgatgcaaagtcgatagcgatggattccgatgatgacgacaacgtcccc
gaggcgcacgcgctgagagccaagcctgagccacaggtctag

DBGET integrated database retrieval system