KEGG   Ustilago maydis: UM05168.1Help
Entry
UM05168.1         CDS       T01021                                 

Definition
similar to gcn5
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
uma  Ustilago maydis
Brite
Enzymes [BR:uma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     UM05168.1
Transcription machinery [BR:uma03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     UM05168.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 510 aa AA seqDB search
MTVVHSNPASRQQSTEPGTINGRYDAKRRKLASSDLAKESTVEANMSTDLSDESAELTGV
EAVEPTANGEDALQEAKKGAANESKSAVCASADADTAEFGQTKVKAEEAVDLEEAMQPAP
KSAASAVEEGVAQKKERPAVIEERTGLIQFRVVTNDDDHESMILLTGLKNIFQRQLPKMP
REYISRLVFDRNHQSVAIVKRGLQVVGGITYRPFKQRKFAEIVFCAITSTEQVKGYGSHL
MNHVKDHVKASSPVMHFLTYADNYAIGYFKKQGFTKEISLDRSIWVGYIKDYEGGTLMQC
SMVPRVKYLEVSDMLAAQKEAILAKIRSISRSHVVHKGLQAMHDRDRLIKLKGLIENPDG
TVAKPERAAKRDQNHGEEDPTATFLVNPSEVPGLKESGWTPEMDELSRRPKRGPHFAVMR
HILVELNGHGSAWPFVNPVNGDEVTDYYDVIKNPMDLSTMEAKLENNQYANLIFDNCRSY
NPASSPYAKSATKLEKFLKETLLPKVQSSL
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtcgttcattccaacccggcatcgcgacaacaatctaccgagcctggcacgatc
aatggacgatatgacgccaagcgaaggaagcttgcatcgtcagacttggcaaaagagagc
acggtcgaagccaacatgtcgacagaccttagcgatgaatcggctgagcttaccggagtg
gaagcggtcgaaccaacagcgaatggcgaggatgcattgcaagaagccaaaaaaggagca
gcaaacgagtcgaaaagcgcagtttgcgcatcggcagacgctgataccgccgaattcggc
cagacaaaggtgaaagcggaagaggccgtcgacctggaagaagcgatgcaacctgcacca
aagagcgccgcatctgcggtcgaagaaggcgtcgcgcaaaaaaaggagcgaccagcggtg
atcgaggagcgtacaggtctcatccagttcagagtggtgaccaacgacgacgatcacgaa
tccatgattctgctcacgggactcaaaaacatctttcaacgtcagctgcccaagatgcca
cgcgagtatatctcgcgtctcgtctttgatcgcaaccaccagagcgtggcgattgtcaag
cgtggattgcaggtggtgggaggcatcacatatcggccattcaagcagcgtaaatttgcc
gagattgtgttctgcgctatcacgagcaccgagcaggtcaaaggatacggctcgcacctc
atgaatcacgtcaaagaccacgtcaaggcttcttcgcccgtcatgcatttcctcacgtat
gccgacaactatgctatcggctatttcaaaaagcagggcttcaccaaggagatcagtttg
gatcgttcaatctgggtgggctatatcaaagactacgagggcggtacgctgatgcagtgc
agcatggtgccacgagttaaatacctggaagtgtcggacatgcttgcggcgcaaaaggaa
gcaatactggccaagatccggagcatcagtcgttcgcatgtggtccataaaggtctgcaa
gccatgcacgaccgcgaccggttgatcaaactcaaggggttgatcgagaatccggatggc
acagtggcaaagccggaacgcgcagccaagcgtgatcaaaaccacggtgaagaggatccg
acagcaacgttccttgtgaatccgtccgaagtgccaggcttgaaggaaagcggttggacg
cccgagatggacgagctgagtcgacggcccaaacgagggccacactttgccgtcatgcgc
cacattctggtggagctcaacggacacggaagtgcgtggccgtttgtgaatccagtcaac
ggagacgaggtgactgactactacgacgtgatcaagaatcccatggatctgtccacgatg
gaagccaagctggagaacaaccaatatgccaacctcatctttgacaactgtcgctcgtac
aatccggcttcatcgccttatgcaaagagcgccaccaagctggaaaagtttctcaaagag
actttgttgcccaaggtgcagagctccttgtga

DBGET integrated database retrieval system