KEGG   Ustilago maydis: UM05171.1Help
Entry
UM05171.1         CDS       T01021                                 

Definition
hypothetical protein
Orthology
K13941  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase / dihydropteroate synthase [EC:2.7.6.3 2.5.1.15]
Organism
uma  Ustilago maydis
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:uma00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    UM05171.1
Enzymes [BR:uma01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     UM05171.1
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     UM05171.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 862 aa AA seqDB search
MSSSEASLELPDIIAVKRLEVRMIVGVDNWERVQAQPVTIDARVHTDVSKAGGSDHLPYS
IHYGVLVKQLEAHCANHRYRSLEALAEGLAKVCIFVLHAPKVTLNVEKPRSLLHAASAGV
QIVRTAADYMLGDLHPIPSNLDPVQCIDELRLAPSSKLALHDKVIVRDLVINTIIGVNPW
EREDKQNVKLNLVVYSGLSRAKEAHNSTAGLIDVVNKQHNYRTIVRSISDYVAASSYKTV
ESLATSIARVAVLQNKVEKVRVSVDKPSAIMFASSAGVEVERTREFFEQEALLEEQQLHA
ATPSAAATAVAPAAAAIIRSGLPHTTSSVSPAQRSPSAMNKSVSNLDKGWHVVAIALGSN
VGDRAANIEAAVQALSEAQDCILVDTSFLYETAPMYVVDQPEFLNAACRIATKLSPHDLL
SLTQSIEVRLGRDKTGVPEKGPRSVDLDILLYDKLEIDDSPRLVVPHPGIKEREFVLEPL
KDILPDFEHPTYSRTISQLLIMLQKSPDYEPSGIRKVLPIPSPSTRPSNQVSDTKMWAWG
SKTFIMGIINATPDSFSDGGDNFGAVDAVRSAKTMAEQGADVIDVGGMSTAPHAVEVDAD
QEATRVVSVIKAIRQAGITIPISVDTFRASVAEAALSVGADIINDVSGGERDPAILKVAK
RWKCPYILMHMRGDSKTMNGLVTYEHGDVVAGVRAELEARLDRALRAGVRRWNIVLDPGI
GFAKDSAGNLALLRDLSRLTLAESVTKSTKGRGVSYSGAATPALDRSVFEAMSPVAQGTS
AQNGADSITRPCCSLVSFPTLIGVSRKKFLGHLTGKQDPKERVFATAAACTAAIAAGADI
LRVHDVEQIRDVAVTSDAIYRH
NT seq 2589 nt NT seq  +upstreamnt  +downstreamnt
atgagttcatcagaagcgtcgctcgagcttccggatattatagcggtcaagaggctcgaa
gtgcgcatgattgtaggtgtcgacaactgggaacgggtccaagctcagcctgtcactatc
gatgctcgcgtccacaccgacgtctccaaggcgggcggatcggatcatttgccgtacagc
attcactacggcgtgctcgtaaagcagctcgaagcgcattgcgcaaatcatcgctatcgt
agtctcgaagcgctcgctgagggtctggccaaagtatgcatctttgtgcttcacgcgccc
aaagtcaccctcaacgtcgaaaagcctcgctccctcctccacgctgcctcggccggcgtt
cagattgtccgcaccgctgctgactacatgctcggcgacctacaccctatcccgtccaac
ctagaccctgtacagtgcatagatgagctcaggcttgctccttcctcgaaactggcgttg
cacgataaagtcattgtgcgcgacctcgtcatcaacaccatcattggcgtcaatccttgg
gagcgtgaagacaaacaaaatgtcaaactcaacctcgtcgtctattccggtctctctcgt
gccaaggaagcgcacaactcgacggctggtctcatcgacgtcgtcaacaagcagcacaac
taccgcacaatcgtacgcagcatctctgactacgtcgctgccagctcgtacaagaccgtc
gagagtctcgccacctcaatagccagggtcgccgtcctccagaacaaggtcgaaaaggtc
cgtgtcagcgtcgacaaaccgagcgccatcatgtttgccagcagcgctggggtcgaagta
gaacgcacacgcgagttctttgagcaagaagcattgctcgaagaacaacagcttcacgct
gcaactccatctgccgccgccaccgccgttgctcctgctgctgctgctatcatccgatcc
ggccttcctcatacgacgtccagtgtatcaccagcgcaacgctcaccttctgcaatgaac
aagtctgtgtcaaacctggacaaaggttggcatgtcgtcgcgattgcccttggctccaac
gtcggcgatcgcgctgccaacatcgaagctgcagtgcaggccctcagcgaagcccaagac
tgcatcctcgtcgataccagcttcctctacgagactgcacccatgtacgtcgtcgatcag
cccgagttcctcaacgctgcctgccgcattgcaacaaagctgagtccgcacgacttgctg
tccctcacacagtcgatcgaagtacggctcgggcgtgacaagacaggcgtaccagaaaaa
ggtcctcgatcggtcgatctcgacattttgctttatgacaagctcgagatcgacgattca
cctcggctcgttgtgcctcatccaggcatcaaggagcgagaatttgtcctcgagcctctc
aaagacatcttgccagactttgagcaccctacctactctcgcaccatatcgcagcttctc
atcatgcttcagaagtcgcctgactacgaaccgagtggcattcgaaaggttttgccaatt
ccttcgcccagcacgcgcccaagcaatcaagtcagtgacaccaagatgtgggcttggggt
tcaaagaccttcataatgggcatcatcaacgctacccccgactcgttctcggatgggggc
gacaactttggagccgtcgatgctgtgcgttcggccaagacgatggccgagcagggcgct
gatgtcattgacgttggcggaatgagcacagcccctcacgcagtagaggttgatgcggac
caagaggcgacacgcgtcgtttccgtcatcaaggctatccgccaagcaggaatcactata
cccatctcggtcgacaccttccgcgcctcggttgcagaagctgcactctccgtcggagca
gatataatcaacgatgtgtcgggaggtgagcgcgatccagcgattctcaaagtggcaaag
aggtggaaatgcccctacatccttatgcacatgcgtggcgacagcaaaaccatgaacggc
ctcgtcacgtacgagcacggcgatgtcgtagccggcgttcgcgccgagcttgaggcacgt
ctcgatcgtgcgctcagggcgggcgttcgaaggtggaacatcgtcctcgatcccggcatc
ggatttgccaaggacagtgccggcaatctcgcgctgctccgcgatctgtcgagactcacg
ctcgccgagtcagtcaccaaatcgaccaagggaagaggcgtttcctactcgggtgcagcc
actccggcattggaccgctccgtattcgaagccatgtctcctgtcgcgcaaggcacgtca
gcacagaacggtgccgactcgatcaccagaccttgctgctcgctagtgtcattcccgact
ttgataggcgtatcgcgtaagaagttccttggccacctcacgggaaagcaagatccaaag
gaacgagtgtttgctaccgctgcggcttgcactgctgccatcgctgctggtgccgacatc
ctcagagtccacgatgtcgagcagattcgcgatgttgccgtcacgtccgatgccatctac
cgtcattga

DBGET integrated database retrieval system