KEGG   Ustilago maydis: UM05240.1Help
Entry
UM05240.1         CDS       T01021                                 

Definition
hypothetical protein
Orthology
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
uma  Ustilago maydis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 565 aa AA seqDB search
MAPRTQKSTSGTPGGSGTPGPDEGPQISPGGTYGLEDVVVGCKAFVQKPDVVTGEMEERK
AEILSIREKPKPRLTKKQQAELADKPAPTLEETLEYYVHYCEFNKRLDEWVSGTRLITSR
ELEWPKKEVTSDKTKRKVIRAGSGATTPSTPLTPTGKGYRGAGASNLLKKAAAQAAKNVQ
GESGLETPQKRKADSGDTSTAQSIRADSIDADADGEDDENGAVVAMEMLGGNDQQEKDDV
ATESNGGLTASLNANQGQETFSKKQEIEKLRTSGSMTQSVSEVARVKNLNKIQMGKSEVE
TWYFSPYPLEYAHIDTLYICEMCLSYFPSPFTLKRHRSKCTLLHPPGNEIYRHEDISFFE
IDGRLQRTWCRNLCLLSKCFLDHKTLYYDVDPFLYYCMVKRDDLGCHLLGYFSKEKDSAE
NYNVACILTLPQHQRAGYGKLLIEFSYELTKIEGKLGSPEKPLSDLGLLSYRAYWAEIIV
ELLLKTEDEISIEEIAQKTAFTHADILHTCMALNMLKQYQGKHMIVLSDLIISKYTAKRP
RKRINPQKLHWTAKNWHRSQLNFGW
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atggcacctcgaacacagaagtcgacaagcggcacgccgggcggctcaggaacgcctggc
ccggacgaaggcccccaaatcagtcccggaggtacgtacggattggaagacgtcgttgta
ggatgcaaggcattcgtgcagaagcccgacgtggtcacaggcgagatggaggagaggaag
gccgagattctgtcgattcgcgaaaaacccaagcctcgccttactaagaagcagcaggcg
gagctggcagacaagccagcgcccactctggaagaaacgctcgagtactatgttcactac
tgcgaattcaataagcgtctcgacgaatgggtcagtggtacacgtctcatcacctcacgc
gagctcgagtggccaaagaaggaagtcactagtgataagaccaagcgaaaggtgattcgt
gcaggcagcggtgcgacaactccctcgacaccgctcacacccactggcaagggctatcgc
ggcgctggtgcgagcaacctgctcaagaaggccgccgcacaggctgccaagaacgttcag
ggggaaagtggtctcgaaacaccacagaagcgcaaagccgattctggggacacctccaca
gcgcaaagcattcgcgccgactctattgatgcggatgcggatggcgaagacgatgaaaat
ggcgccgtggttgccatggagatgcttggcggcaatgaccagcaggagaaggacgatgtt
gctaccgagagcaatggcggcctcactgcatcgctcaacgccaatcaaggtcaagagacg
tttagcaagaagcaagagatcgaaaaattgcgaacgtcgggctcaatgacgcaatcggtc
tccgaagtggcaagagtcaagaatctcaacaagatccagatgggcaaatccgaggtagag
acgtggtactttagtccttatccgctcgaatacgcccacattgataccttgtacatctgc
gagatgtgtttatcgtattttccttcgccctttactctcaaacgtcatcgaagcaagtgt
acgctcttgcatccgccgggcaacgagatctaccgccacgaagacatttccttcttcgag
atcgacggccgacttcaaaggacgtggtgtcgaaatttgtgcttgctgagcaagtgcttt
ctcgaccacaagacgctctactacgacgtcgatcctttcctgtactactgcatggtcaag
cgcgatgacctcggttgccacctgctcggctacttttccaaagagaaggattcggccgaa
aactacaacgttgcctgtatcttgacattgcctcagcaccagcgagccggctacggtaag
ctgctcattgaattctcgtacgagctcactaagatcgaaggcaagctcggcagtcccgaa
aaaccgctctccgatctgggtctactcagctaccgtgcctactgggccgagatcattgtc
gaattgttgctcaagaccgaagacgagatcagcattgaggaaattgcccaaaagacggct
ttcacccacgccgacatcctacatacctgcatggcactcaacatgcttaagcagtaccaa
ggcaagcacatgattgtcttgagtgacttgattatctcaaaatatacggccaagcgtcct
agaaaacgcatcaatccacagaagctgcactggaccgccaagaattggcatcgctcccag
ctcaatttcggctggtag

DBGET integrated database retrieval system