KEGG   Ustilago maydis: UM05352.1Help
Entry
UM05352.1         CDS       T01021                                 

Definition
hypothetical protein
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
uma  Ustilago maydis
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:uma04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
19
AA seq 537 aa AA seqDB search
MATSPLSWTFSLALIALCLFSTTNAALFAKNSKVTILDSSNFKREVLDIEKPTMVAFTAP
WCGHCQKLVPDYSKVAAQLDGVVKMASIDCDDDKNKPTCGKYGIQGFPTLKLFPPTKKRL
PKDYQGPRSAKDIAAYMVDALPMGAKKLKAEELQEYADKDAETPKVILFSKKPTSSPLYK
SLALDFRKSLSFAFLRGDQRPVQAAARIHLGVDVRDDQLPYLIVVPSRASGEKVDKSKIK
AYTGALKYYDLNEWIKQTIPEAKSGKVKKVGTKANVKKKPIKLDQDIQDVPEGANREWRM
EEEMTEEEKRKKMEELAEMLNTAIKQSNDLRDGKAPSSADTGNSETPPVVKSDTNSSAHS
SSEGSHSSSWSSSYSSSTDSDGKKNIHRSASHSSSGDSPDSASTYKVSSHTESDDISLKE
NLQRWLEGEKVDWSADYATQFKDAQRAAEDLIANDPEKADQMALESEKWLAHYLVSDLDM
MKIAKDKGNQDPALSDDKIERVERMYNEILKRIEERESKFKEKESQAETPSKGHDEL
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atggcaacatcaccccttagctggacattcagtctggcgctgatagcactctgccttttc
tccactaccaacgccgccctcttcgctaagaattccaaggttaccatcctcgactcctcc
aacttcaaacgggaagtgctcgacattgagaagccgaccatggtagctttcaccgctcct
tggtgtggacactgtcagaagcttgtaccagactattccaaggtcgctgctcaacttgac
ggtgttgtgaaaatggcctcgatcgactgcgatgacgacaagaacaaacccacttgcgga
aagtacggcattcagggcttcccgacgctgaaactcttcccaccgaccaagaagcgcctt
ccgaaggactatcaagggcctcgatcggctaaagatatcgctgcgtatatggtggatgcg
cttcccatgggtgccaagaaactcaaagcggaagagctgcaagagtatgctgacaaggat
gccgaaacgcccaaagtgatcctgttttccaagaagccaaccagctcaccgctgtacaag
agtcttgcgctggactttaggaagagtctgtcgtttgcgttcctcagaggagatcagagg
ccagtgcaggctgctgcgaggatccatctgggagtcgacgtaagggacgaccaattgcca
tacttgattgtggttccatcgagggccagtggtgagaaagtggataagagcaagatcaag
gcatatactggtgcgctcaaatattacgatttaaatgagtggatcaagcagacaattccg
gaggcaaagtcgggtaaggtgaagaaagtaggcacgaaggcgaatgttaagaagaagccg
atcaagctggatcaggatattcaagacgttcccgagggtgcgaaccgggaatggaggatg
gaagaggagatgacggaagaagagaaaagaaagaagatggaggagttggccgagatgctc
aacacagcgatcaaacagtcgaacgaccttcgcgatggtaaagcaccatcctctgccgac
accggaaacagcgaaacacctccagtggtgaagagcgataccaattcaagcgcacactcc
agcagcgagggatcgcactcgtcgtcgtggtcatcatcctactcttcttcaaccgattcc
gatggcaaaaagaacattcatcgtagcgcatcccactcttcttctggcgactcacccgat
tccgcctccacgtacaaagtgtcctcccacaccgagtccgacgacatctcgctcaaagaa
aatcttcaacgctggctcgaaggcgaaaaggtcgactggtctgcggactatgcgactcag
ttcaaagacgctcaacgtgcagctgaagatctcatcgccaacgatcccgaaaaggcggac
cagatggcgttggaaagcgaaaagtggctagcacactatctggtatccgatctggatatg
atgaagattgctaaagacaagggcaaccaagatcccgcgctgagcgatgataagattgaa
agggtggaaaggatgtataacgagattttgaagaggatcgaggagcgggagagcaagttt
aaggaaaaagagagtcaagccgaaactccgagtaaaggtcatgacgagctttga

DBGET integrated database retrieval system