KEGG   Ustilago maydis: UM05433.1Help
Entry
UM05433.1         CDS       T01021                                 

Definition
hypothetical protein
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
uma  Ustilago maydis
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:uma00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    UM05433.1
Enzymes [BR:uma01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose-protein mannosyltransferase
     UM05433.1
Glycosyltransferases [BR:uma01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   UM05433.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
19
AA seq 777 aa AA seqDB search
MVDATKAQTLRSRRNDSATAHTTDAVASTRADHSIVTDVKLGSKSNWGVVSPHVHSHAAD
SLITLVLFALAAALRLYRISFPDQVVFDEVHFGKFAAYYLRREFHFDVHPPLAKLINAFA
GYLAGFDGHFEFDQIGDKYLDNNVPYIRMRAVPAIIGSLQVPLVYAIMRQSGYAPVIGVF
SAALLLFDNAHIAQDRLILLDAPLILFMMLSLYSYIRFYKLRYNEFSSEWWVWLCATGVN
LALTMSCKMVGLFTFITIGSAVAWDLWKLLDIRRGLEIEHVARHFFARFFALILLPFGVY
LFWFWVHFAILIKSGPGDVFMSSQFQQTLTGNEMLSNARDIQYFDKLTLMHKNTKALLHS
HVERYPLKYDDGRISSQGQQVTGYPHNDTNNVWQIIPTKPIPDHDATGRLVHHKDTLRLL
HVNTDSYLLTHDVASPLMATNEEFTTVPANDTSRYDDTLFELHLDEADGTDKVVKSRASW
FRLVHKNTRVCMWTHGEALPDWAFNQQEVNGNKNAMDKTCLWYVEDLTPSPESPDYEERL
KPLAPRKVVKMNFFKKWLELQLQMLQQNAGLTQSHPYATGPINWPFLLQGISFWTQDAGQ
HQIYMIGNLVSWWGTILAISIFVGVVGADLLARRRAIYPIPSAVRNRLHNSSGFFVMAWA
CHYLPFFLMSRQLFIHHYLPAHVCACLVAGGVLNFVTSETIQFPISKPGPLLTPRHYRPR
MDNIVPQQARAFMALVIGALIVCFWWLSPLTYGTPGLTNAEVHARRLLPSWTLHFAK
NT seq 2334 nt NT seq  +upstreamnt  +downstreamnt
atggtcgacgctacaaaagcacagacgctgcggtcacgtcgcaacgactctgccactgca
cataccaccgacgccgtcgcatccactcgagccgaccactcgatcgtaaccgatgtcaaa
cttggctccaagtcgaactggggcgtggtatcgcctcacgtccattcgcatgcagcagac
tcgctcatcacgttggtgctctttgcactggctgctgcgcttcgcttgtatcgcatatcg
ttccccgatcaggtagtgtttgacgaggtccactttggcaagtttgccgcctactacctt
cgtcgcgagttccactttgacgtgcatcctccgcttgcaaagctcatcaatgcctttgca
ggctacctagctggttttgacggtcactttgaattcgaccagatcggcgacaagtacctc
gacaacaacgttccctacattcgaatgcgtgccgtgcccgccatcatcggcagtctgcag
gtgcccctggtttacgccattatgcgtcagagtggatatgcgcccgtcattggcgtcttt
agtgcggctctactgctctttgacaatgctcacatcgcccaagatcgtctgattctgctc
gatgctcctctgatcctcttcatgatgctcagcctgtactcctacatccgcttctacaag
cttcgctacaacgagttttcgtccgaatggtgggtttggctctgcgctaccggtgtcaat
ctcgccttgaccatgagctgcaagatggtcggtcttttcacctttatcacgatcggctcc
gccgtcgcctgggatctctggaagctcctcgacattcgacgaggtctcgagatcgagcac
gtcgcgcgccactttttcgcgcgcttctttgccctcatcctcctcccctttggcgtctac
ctgttttggttctgggtccactttgccattctcatcaagagcggtcctggcgatgtgttt
atgagctcgcaattccagcagacgctcactggcaacgagatgcttagcaacgctcgcgac
atccagtactttgacaagctcaccctcatgcacaaaaacacaaaggccttgcttcactcg
cacgtcgaacgctatcctctcaagtacgacgatggacgcatctccagtcaaggccaacag
gtcaccggctacccgcacaacgacaccaacaacgtctggcagatcattccaactaaaccc
atccccgatcacgacgccactggccgtctggtgcaccacaaggacaccctccgactgctt
cacgtcaacacggactcgtatctgctcacgcacgacgtcgcgtcgccgctcatggccact
aacgaagagttcaccacggtacctgccaacgacacttcgcgctacgacgacacgctcttt
gaacttcacctcgacgaagccgatggcaccgacaaggtggtcaagagcagggcgtcttgg
ttccgactcgtccacaagaacacgcgcgtctgcatgtggacccacggcgaggcgcttccc
gattgggctttcaaccagcaggaagtcaacggcaacaagaatgccatggacaaaacttgt
ctgtggtacgttgaagatctcacccctagccccgagagcccggactatgaagagcgactc
aagcctcttgcgccgcgcaaagtggtcaagatgaactttttcaagaaatggctcgagctt
cagctgcagatgcttcagcagaatgccggcctcactcagagccacccttacgctacagga
ccgatcaactggccgtttttgcttcaagggatctctttctggacgcaggacgctgggcag
catcagatctacatgatcggcaacctcgtctcatggtggggcacgattctcgccatttcc
atttttgtcggtgttgtgggcgctgacctgctcgcacgtcgtcgcgccatctacccgatt
cccagcgcggtacgcaaccgcttgcacaactcgagcggcttctttgtgatggcgtgggcg
tgccactatctgcccttcttcctcatgtcgcgtcagctcttcatccaccactatctccct
gcacacgtctgcgcgtgtctggtggctggcggcgtgctcaactttgttaccagcgagacg
atccaattccccatctcgaaaccaggtccgctgcttacccccagacactaccggccgagg
atggacaatatcgtgccgcaacaggcgcgggctttcatggctctcgtcatcggtgctctt
atcgtgtgcttttggtggttgagcccgctcacttacggcacgcccggtcttaccaacgca
gaggtgcatgccagaaggctcttgccatcctggacgctccactttgcaaagtga

DBGET integrated database retrieval system