KEGG   Ustilago maydis: UM05474.1Help
Entry
UM05474.1         CDS       T01021                                 

Definition
hypothetical protein
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
uma  Ustilago maydis
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:uma00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    UM05474.1
Enzymes [BR:uma01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose-protein mannosyltransferase
     UM05474.1
Glycosyltransferases [BR:uma01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   UM05474.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
18
AA seq 866 aa AA seqDB search
MLPTSRADAPKRSSYTNITIDHPHAVSSATSPYATTAALDSDQDLPAPYRKRYIDSHDTL
LPTHSPPSSTYLSQDSPGRMSSPAANSRRFAAGFDPYSPATTVDSDHADLSSDSAALKAK
EAGFQPPSSNTPKVNKYAHLIPVHQQRKPPNFEIVLWTLRQEEVIGLIYTLFSLITRLWG
IGNSNVVVWDEAHFGKFGSHYLQQEFYFDVHPPLGKMLVGLAGLISGYRGQFEFKSGETY
PADVNYIGMRVILAMFGVAMVPLAWFTSGGLNWNWRARHLLTLMVLLDNGWLVISRFILL
DSMLLCFTFTTVHGLVKFLQYKSAPFTKAWWFWLAFTGASIGCVSSVKWVGLFVTALVGV
FTVEDLWEKFGDLRMPVRAYVRHWCARILCLIFLPLTIYMLSFKAHFLILSRSGPGDAQM
SSLFQSHLRGNDFALSPPEAAFGSKITLKNMGYGGGLLHSHVQTYPVGSQQQQVTCYHYR
DNNNEFIITPPWNERALPANYSSSTEPVRMLKNNDVIRLVHDQTKRNIHSHHVAAPVTKE
NLEVSGYGDDQTGDDNDHWVVEVVDDMVHGKVARDAPVRSLTSRLRLRHKNLGCYMRAAN
AVLPQWGWKQVEVSCDKENNPKDQHTWWNIENHWNERLAPGDSQLYKSPFLRDFIHLNVA
MMTSNNALIPDADKEDILASKPFDWPWLWNGLRMNSWDDNSIKFYLLGNPVIWWASSSSL
LAFGATWLWYMMRRQRRIHDLSPADWAHFLYVAKLAAFGWLLHYLPFLVMARVCYLHHYL
PILYFAVLMLVHLIDHFVWRPSTAVYAFGASRRKQPLSEALKNAVFVVSVVAITAAFWWF
RGNSYGFKGDIKSHKGLKWRKSWNIY
NT seq 2601 nt NT seq  +upstreamnt  +downstreamnt
atgctacccacctcgcgcgctgacgctccaaagaggtcctcctacaccaacatcaccatc
gatcacccacacgccgtctcatccgcaacttcgccttacgccaccacggccgccttggac
tcagaccaggacctcccagcgccgtaccgcaaacgctacattgacagccacgatacgctc
ctccccacccactccccgccttcgtccacctacctctcacaagactcgccaggaagaatg
agtagcccagctgctaacagccgccgcttcgccgccggctttgacccttactcgcctgct
accacggtcgattcagatcacgccgacctctcctcggactcggccgcgctcaaagcaaaa
gaggccggctttcaaccgccgtcctccaacacgcccaaggtcaacaagtatgcgcacctc
atccccgtccatcaacagcgcaagccgcccaactttgaaattgtcctctggacgctgcgc
caggaagaagtcatcggccttatctacacccttttctcgctcatcacgcgtctctggggt
atcggcaatagcaacgtcgtcgtttgggacgaggcgcatttcggaaaattcggctcgcac
tacctgcaacaggagttctactttgacgtccatccgcctctcggcaagatgcttgtcggc
ctcgccggtctcatcagtggctaccgaggtcagttcgaattcaagtccggggaaacctac
ccggccgatgtcaactacatcggtatgagggtcatccttgccatgtttggcgtggcaatg
gtccctctcgcctggttcaccagcggcggtctcaactggaactggcgcgctcgtcacctg
ctcacgttgatggttctcctcgacaatggctggctcgtcatctcgcgcttcatcctgctc
gactcgatgctcctgtgtttcacctttaccaccgtccatggcctggtcaagtttttgcag
tacaagtcggctcccttcacaaaggcttggtggttctggctcgctttcactggcgcttcg
atcggctgtgtctcgtcagtgaaatgggttggtctctttgttaccgcgctcgtcggtgtg
tttacggtcgaagatctctgggaaaagtttggcgatcttcgtatgcctgttcgcgcgtat
gtgcgtcactggtgcgcgcgcatcctctgcctgatcttcttgcctctgaccatctacatg
ctcagcttcaaggcgcactttttgatcctcagccggtctggtccaggcgatgctcagatg
agcagtctcttccagagccatcttcgcggcaacgactttgctctctcaccgcccgaagct
gcgtttgggtccaagatcacgctcaaaaacatgggctacggaggcggcttgctccactcg
cacgtccagacgtaccctgtcggatcgcagcagcagcaagtcacctgctatcactaccgc
gacaacaacaacgaattcatcatcacgccgccttggaacgagcgcgcgttgccggccaac
tactcttcctccaccgagcccgtacggatgctcaagaacaacgacgtgatccgtctggtt
cacgaccagacgaagcgtaacattcattcgcatcacgtcgccgctccagtcacaaaggag
aacctcgaggtgtcgggctacggagatgaccagaccggcgacgataacgaccattgggtg
gtcgaggtggtggacgacatggtgcatggcaaggtggctcgcgatgcgcctgtgcgctca
ttgacgagccgactgaggctgcgacacaagaacttgggctgctacatgcgtgctgccaat
gctgtactgccacagtggggttggaagcaggtcgaagtgtcgtgcgacaaggagaacaat
cccaaggaccaacacacctggtggaacatagagaatcactggaacgagcgtcttgcgccc
ggtgattcgcagctttacaaatcgccgttcctgcgcgactttattcacctgaatgtggcc
atgatgacgtcgaacaacgcgctgattccggacgcggacaaggaagacattctggccagc
aagccgttcgactggccgtggctgtggaatggactgaggatgaattcctgggacgacaac
tcgatcaagttctacctgctcggcaacccggtgatctggtgggcgtcgtcgtcgtcgctg
ctcgcgttcggcgcgacatggttgtggtacatgatgcgacgtcaaaggcgcatccacgac
ctctcgcctgcggactgggcgcactttttgtacgtcgccaaactcgctgcgtttggctgg
ctgcttcactatctgccgtttttggtcatggcgcgcgtctgctacttgcaccactacctg
cccatcctctactttgccgtgctcatgttggtgcatctcatcgaccatttcgtctggcgt
cccagcaccgccgtctatgcgtttggcgcaagccgcagaaaacagccgctgtccgaagcg
ctcaaaaacgccgtctttgtcgtcagcgtcgtcgcgatcaccgccgcattctggtggttc
agaggtaacagctatggtttcaagggtgatattaaatcgcacaagggcctcaagtggcgt
aagagctggaacatctactga

  All links  
No link information was found.   
DBGET integrated database retrieval system