KEGG   Ustilago maydis: UM05561.1Help
Entry
UM05561.1         CDS       T01021                                 

Definition
hypothetical protein
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
uma  Ustilago maydis
Pathway
Glutathione metabolism
Class
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:uma00480]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
18
AA seq 242 aa AA seqDB search
MSKSIALPALTASIPAFYHFLAPKSTTVQGLFLPVGYGYVVSCVVSAAWVTFLMGVKVGS
ARRAAQIPYPYQYADRAVADKNREAHLFNCAQRVHQNTLENLTSFAFLTLFNGLFFPQLT
TVVSATWVISRIPYAIGYYSGTPSNRAFGAIPSGLSFLACESERRAPVRRIELTRPTGTL
AATSKDHLQLTTQSAAWYYQFTNCHEYMRRKSIQVASSKRHSLAAFKAENIDFIRNTYVL
PE
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaagagcatcgccctacccgcacttaccgcctccatcccggcgttttaccacttc
ctcgcccccaagtccaccacggtccagggcctgttcctgcctgttggctatggctatgtg
gtctcgtgtgttgtctcggccgcctgggtcaccttcttgatgggtgtcaaggtgggtagc
gcacgcagagctgctcaaatcccttatccgtatcagtacgccgaccgagccgtcgcggac
aagaaccgagaggctcatctcttcaactgcgctcagcgtgttcaccagaacaccctcgaa
aacctcacgagcttcgcatttctcacgctattcaacggtctcttcttcccgcaactcacc
actgtcgtctcggccacttgggtcatctcacgtattccttacgcgatcggttactactcg
ggtacgccaagcaatcgtgctttcggtgccattcccagcggtctcagcttcctcgcttgc
gagtccgaacgacgtgcaccggtacgcaggattgagctaacgagaccaacaggcacgctt
gccgcaacaagcaaagaccacttgcaactgactactcagagtgctgcctggtactaccaa
ttcacgaattgccacgaatacatgcgtcgcaagagcatacaggtcgcgtcttccaaacga
cacagtctagctgcgttcaaggctgagaatatcgatttcattcggaacacttatgttttg
ccagaatga

DBGET integrated database retrieval system