KEGG   Ustilago maydis: UM05584.1Help
Entry
UM05584.1         CDS       T01021                                 

Definition
hypothetical protein
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
uma  Ustilago maydis
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, eukaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:uma00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    UM05584.1
   00052 Galactose metabolism
    UM05584.1
   00500 Starch and sucrose metabolism
    UM05584.1
   00520 Amino sugar and nucleotide sugar metabolism
    UM05584.1
Enzymes [BR:uma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     UM05584.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
18
AA seq 509 aa AA seqDB search
MSSNATLSTPNSGAQIKASRTRGASHIDFKSATTGVAAKAMRNEINALVSGIDDPAVRKA
FDAEMSNFFTLFNRYLSEKAKGEKLVWDKIQPPSPKQITPYSELRNATDPSILNKLAVLK
LNGGLGTTMGCTGPKSVIEVREGMTFLDLSVRQIEHLNSSHNVNVPFILMNSFNTDDDTA
RVIQKYANHNVEILTFNQSRYPRVNKESLLPCPRSATDNKNLWYPPGHGDLFDAMNNSGL
LDRLISAGKEYLFVSNVDNLGADVDLNIYQHMIDTQAEFISEVTDKTKADVKGGTLIDYE
GTIRLLEIAQVPSEHVEDFKSVKKFKIFNTNNLWLNLRAVKRVLENEELDLEIIVNNKAL
DSGEAVIQLETAVGAAIKHFRGAKGVNVPRSRFLPVKSCSDLLLITSDLYSLEHGKLVMN
PGRMFSQTPVVKLGDTFKKVAQFQKRFKSIPEMIELDHLTVQGDVVFGRNITLRGTVIIV
ANEGNKIEIPEGSVLENKLISGNLAIIDH
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgtcttccaacgctactctctccacgcccaacagcggtgcacagatcaaggcttcgcgc
acccgtggtgcctcccacattgacttcaagtcggccaccaccggtgtcgctgccaaggct
atgcgcaacgaaatcaacgctctcgtgtctggcatcgatgatcctgccgttcgcaaggct
tttgatgccgagatgtccaactttttcaccctcttcaaccgctacctctctgagaaggca
aagggtgagaagctcgtctgggacaagattcaaccgccttcgcccaagcagatcactcct
tactccgagctccgaaatgccactgatccctcgatccttaacaagctcgctgtgctcaag
ctcaacggtggtcttggtaccaccatgggttgcaccggtcccaaatcggtcatcgaggtc
cgtgaaggcatgaccttcctcgacctttccgtgcgtcagattgagcacctcaacagctcg
cacaacgtcaacgtcccctttatcctcatgaactcgttcaacacggacgatgacactgcc
cgtgtcatccagaagtacgccaaccacaatgtcgagatcctcactttcaaccagtcgcgc
tatccgcgtgtcaacaaggagtcgctcctcccctgccctcgctctgctactgacaacaag
aacctctggtatcctcccggtcacggcgatcttttcgatgctatgaataactctggtctc
ctcgaccgcttgatctctgccggcaaggagtaccttttcgtctccaacgtcgacaatttg
ggtgccgacgtcgacctcaacatctaccagcacatgatcgacactcaggccgagttcatc
tcggaagtcactgacaagaccaaggccgacgtcaagggtggtacgctgatcgactacgag
ggcactatccgtcttctcgaaatcgcccaggtgccctcggagcacgtcgaggatttcaag
tcggtcaagaagttcaagatcttcaacaccaacaatttgtggctcaacctgcgcgcggtc
aagcgtgtcctcgaaaacgaggagctcgacctggagattattgtcaacaacaaggcgctc
gattccggtgaagccgtcatccagctcgagactgccgtcggtgctgccatcaagcacttc
cgcggtgctaagggtgtcaatgtgccacgatcgcgtttcttgccggtcaagtcgtgctcc
gatctcctgctcatcacttcggatctctactcgctcgagcacggcaagttggtcatgaac
ccaggccgcatgttctcccagacgcccgtcgtcaagctcggtgacacgttcaagaaggtc
gcccagttccagaagcgtttcaagtcgatcccagaaatgatcgagcttgaccaccttaca
gtgcagggcgacgttgttttcggtaggaacatcaccctccgtggtaccgtcatcattgtc
gctaacgagggtaacaagatcgagattcctgagggcagtgtgctggagaacaagctgatt
tcgggcaacttggccatcattgaccactaa

DBGET integrated database retrieval system