KEGG   Ustilago maydis: UM05641.1Help
Entry
UM05641.1         CDS       T01021                                 

Definition
hypothetical protein
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
uma  Ustilago maydis
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:uma00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    UM05641.1
  Lipid metabolism
   00062 Fatty acid elongation
    UM05641.1
Enzymes [BR:uma01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     UM05641.1
Lipid biosynthesis proteins [BR:uma01004]
 Fatty acid synthase
  Component type
   UM05641.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
16
AA seq 402 aa AA seqDB search
MRVSTSVALLGSLAASVFLLSSSVEAVPFSLLPKPHPLVIWHGLGDSAHSEGIESFMSQL
KEAFPGLYVHSVTQDASNDSEDRRQGFFGHVNDQVQKACEQLASIDELRNGFDAIGFSQG
GQFLRAYVQRCNAPKVRNLVTFGSQHMGIADLPACGPADLLCRVAEAALRGGIYTDYAQS
HLVSAQYYRNPKDPRAFASYLEKNDFIKDINNEGNQINTTYAKNLASLENFVMLMFDKDT
TVEPRQSSWFASYPIRNGTDSLEQGDPDEPTPLRQSSIYLDDRIGLRQLDRRGSLIMELC
HGLHMQIDAACQLKVFGKYVGTSGSRFSGSLARWIDHSWRLALYNTTGWRVEETGGLMLT
QSLLFVGLFVVVRLLFVMLVRAIDAASRTRTHHDNPGPIRLP
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtctcaacaagcgtggctctgctcgggtcccttgccgcctcggttttcttactg
tcgagttcagttgaggccgttccattctcgttacttcccaaacctcatcctcttgtcatc
tggcatggtcttggagatagcgcgcactcggaaggaatcgagtcgttcatgtcgcagctt
aaagaggcttttccgggcctctacgtgcattcggtcacgcaggacgcatcaaacgactcg
gaggaccgcagacaggggttttttggtcatgtcaatgatcaagtgcaaaaggcgtgcgaa
cagctcgcttcgatcgacgagcttcgcaatggattcgacgccattggcttctcacagggc
ggacagttccttcgagcatatgtgcagcgctgcaacgctccaaaagtacgcaacctggtc
acttttggcagtcaacatatgggcattgccgatctacccgcttgcggtcccgcggatttg
ctctgccgcgttgccgaagccgcactgcgaggaggcatctacaccgactatgcgcagtcg
catcttgtctctgcccagtactatcgcaaccccaaggatcccagagcattcgcttcctac
ttggaaaaaaacgatttcatcaaggacatcaataacgaaggtaaccagatcaacaccacg
tatgccaagaatcttgcttcgctcgaaaactttgtcatgctcatgtttgacaaggacacc
accgtcgaacccaggcaatcctcttggttcgcctcgtatcctatccgcaacggaaccgat
tcactcgaacaaggcgatccggatgaaccgacgccattgcgacagagttccatctacctc
gacgaccggatcggtctgcgacaactcgatcgacgaggttcgctcatcatggagctgtgt
catggattgcacatgcagatcgatgctgcatgtcagctcaaggtgtttggaaagtacgtc
ggcacatctggctcgcgtttcagcggctcgttggccagatggatcgaccacagttggcgc
ttggcgctctacaacaccacgggttggcgcgtcgaggagactggcgggctcatgctcacg
cagagcttgctcttcgtcggcctgtttgtggtcgtccgattgctgtttgtgatgcttgtg
cgtgccatcgatgctgcatctcgtacgcgcacccatcacgataatcccggcccgattcgt
cttccctag

DBGET integrated database retrieval system