KEGG   Ustilago maydis: UM05703.1Help
Entry
UM05703.1         CDS       T01021                                 

Definition
hypothetical protein
Orthology
K00273  
D-amino-acid oxidase [EC:1.4.3.3]
Organism
uma  Ustilago maydis
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
D-Arginine and D-ornithine metabolism
Metabolic pathways
Peroxisome
Brite
KEGG Orthology (KO) [BR:uma00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    UM05703.1
   00330 Arginine and proline metabolism
    UM05703.1
  Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    UM05703.1
  Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    UM05703.1
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    UM05703.1
Enzymes [BR:uma01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.3  D-amino-acid oxidase
     UM05703.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
16
AA seq 365 aa AA seqDB search
MTNQLHVVVLGAGVLGLTDAFELRERGYRVTILARDLPFDSFSQTFASPWAGANWCSFAT
LDDKPAQRRDEITFKKWLKLHTRLPEEVMAIMEFTDIGLTKRDTKDVWFSNLTPEFSVLP
DADEMGAHAIKYKSFTISVPLYTRWLVSELTSTKPILLDATRAGPPVEIRRCSTLTSLSA
VRSLVPGCDLVVNATGVGAADLADVRDPNVYPIRGQTVLINVPSFASPNRAARCVMKLSK
PNAYYVIPRARSGQVILGGSFELRQSSTTPDRNLAERIMEECAKLVPEIVPEGKTWKDID
VVSHNVGLRPARENGARVELERLGGNGLTVVHSYGIGPAGYQASFGIAKEVADLVDKHAG
RQSRL
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatcaacttcacgtagtggtcctcggcgctggagtgcttggactgaccgatgcc
tttgagctgcgcgaacgcggctacagagtgaccatcctcgcacgcgatctacctttcgac
tctttctcccagaccttcgccagtccttgggctggagccaactggtgttccttcgctact
ctcgacgacaagccagcacagcgtcgagacgaaatcacgtttaagaaatggctcaagctt
cacacgcgtttaccagaggaagtaatggcaataatggagtttaccgatatcggcctcacc
aagcgagataccaaggatgtatggttcagcaacctgactcctgaattcagcgtcctgcca
gacgccgatgaaatgggagcgcatgcaatcaagtacaaatcttttactattagcgtaccg
ctgtacacgcgctggttggtgtcggagttgacttcgaccaagcccattctccttgatgct
acgcgagccggtccgccagtagaaatccgacgatgctccacgctaaccagcttatccgct
gtacgatcactcgtaccaggctgcgatttggtagtcaatgcgacaggcgtaggagcggca
gacttggccgacgtacgcgatcccaacgtctacccaattcgtggacaaaccgttcttatc
aatgtaccatccttcgcctcccccaatcgcgctgctcgctgcgttatgaagctctccaag
cccaacgcctactacgtcattccacgagcaaggtctgggcaagtcatcctcggtggaagc
tttgaacttcggcaatcatccaccacccctgatcgcaacttggcggaaaggatcatggaa
gagtgcgcaaagctggtgcctgaaattgtacccgagggaaagacatggaaagatatcgac
gttgtttctcacaatgtcggcttgagacctgctagggagaatggggctagggttgagttg
gagaggttgggaggaaatgggttgacggtggttcattcgtatggaatcggtccggcaggc
tatcaggctagttttggtatcgcaaaggaggtggctgatctggtggataagcatgctggt
cgccagtcgaggctgtag

DBGET integrated database retrieval system