KEGG   Ustilago maydis: UM06273.1Help
Entry
UM06273.1         CDS       T01021                                 

Definition
hypothetical protein
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
uma  Ustilago maydis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 722 aa AA seqDB search
MASQLDLFVLGLGGLLAVLYLFRDSLFGGAKDTGSKLANGAPLAATDQGGADFVSKLKSQ
NKRIAIFYGSQTGTAEEYATKLAKEAKARFGTSSLVLDPEEYEFDKLDQMPQDTVAVFVM
ATYGEGEPTDNAVGLMEFIENESPEFSNGSERLENLNYVIFGLGNRTYEHFNAVARKLDA
RLQSLGAKRIGERGEGDDDKSMEEDYLAWKDSMFEALATSLNFEEGGGGDVPDFKVTELA
NHPDDKVYHGELSARALLGTKGIHDAKNPYNAVVKEARELFVQGTADRTCVHIEFDIDGS
GISYQHGDHIAVWAHNPEPEVDRVLAVFGLLDKRTTVIDVESLDPTLAKVPFPVPTTYEA
VFRHYIDITSHASRQTLNSFAKFAPSPDIQAKLEKVCANKDIFQAEIGSRLLKTTEAMQW
IAGDDLQADVSSIKPWNVPFDRVISDLPRVGPRFYSISSSPKMHPKSVHITAVVLRYQAN
KSAPWVHGLATNLISSIKMAKNGEQPTGPSDPRYGTPKYLLDGPRGAYTKDGAFRAPIHI
RRSNFRLPTSPKIPVIMVGPGTGVAPFRSFVQDRVCSAEKALEKSNGKSAQEALKDWGNL
WLFYGCRKADEDFLYRDEWPQYAQKLGGKFIMETSLSREKFKPDGSKLYVQDLIWERRKQ
IAEDILERKAYIYICGEAKGMAHDVEAIFGKILEEAKGSAEEAKKEIKLLKERSRLLLDV
WS
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atggcttcgcaactcgacttgttcgttctcggtctcggaggcttgctagccgtcctttat
ctgttccgtgacagcttgttcggcggtgccaaggacactggttccaagcttgccaatggc
gcccctctcgctgctaccgaccaaggtggcgccgactttgtctcgaagctcaagtcccaa
aacaagcgcatcgccatcttctacggctcccaaaccggtaccgccgaagaatacgccacc
aagctcgccaaggaggccaaagcccgttttggcacctcttctctcgtcctcgatcccgag
gagtacgagttcgacaaacttgaccagatgccccaagacaccgttgccgtctttgtcatg
gcaacttacggcgagggtgagcccacggacaatgccgttggcctcatggagttcatcgaa
aacgagtcgcccgaattctccaacggcagtgagcgtctcgagaacctcaactacgtcatc
tttggccttggaaatcggacctacgagcatttcaacgctgttgcccgcaagctcgatgcg
cgtcttcagtctctcggcgccaagcgcattggcgagcgaggcgaaggtgacgacgacaag
agcatggaggaagactacttggcctggaaggactccatgttcgaggcacttgccacttcg
ctcaactttgaagagggcggtggaggtgatgtgcccgatttcaaggtcaccgaacttgcc
aaccaccccgatgacaaggtctaccacggcgagctttccgctcgtgcgctgcttggcacc
aagggcattcacgacgccaagaacccgtacaacgccgtcgtcaaggaggctcgcgagctg
tttgtccaaggcaccgccgatcgtacttgcgtccacatcgaattcgacattgatggctcc
ggaatctcgtaccagcacggcgaccacattgccgtgtgggcacacaaccccgagccagag
gttgaccgtgttctcgccgtatttggtctcctcgacaagcgcaccaccgtgatcgacgtc
gaatcgcttgaccccacccttgcaaaggtgcccttccccgtccccaccacgtacgaagcc
gtcttccgacactacattgacatcaccagccatgcctcaagacaaacgctcaacagcttt
gccaagtttgccccttcgcccgatatccaagccaagctggaaaaggtctgtgccaacaag
gacatttttcaggccgaaatcggcagtcgcttgctcaagaccacagaggccatgcagtgg
atcgccggcgacgatcttcaggctgacgtcagctccataaaaccctggaacgtacccttt
gatcgtgtaatctcggatcttcctcgtgttggtcctcgcttctactcgatctcgtccagc
cccaagatgcaccccaagtcggtccacatcacggctgtcgtgctccgataccaggccaac
aagtccgccccctgggtgcacggtcttgccaccaacttgattagctccatcaagatggcc
aagaatggcgagcagccaactggtccctccgacccgcgctatggcaccccaaagtatttg
ctggacggtccgcgaggcgcttacacaaaggacggcgcattccgtgctcccatccacatt
cgacgctccaactttcgtctacccacctcgcccaagattcctgtcatcatggtcggtccc
ggtactggcgttgcgcctttccgctcttttgtgcaagatcgcgtttgcagcgccgaaaag
gcactcgagaagtccaacggcaagtcggctcaggaggcgctcaaggactggggcaatctc
tggctcttctacggctgcaggaaggccgacgaagatttcctttaccgtgacgagtggccg
caatacgcacagaagctcggcggcaagttcatcatggaaacctcgctttcgcgcgaaaag
ttcaagcctgacggctccaagctttacgtgcaggacttgatctgggagcgacgcaagcag
attgccgaggacattctggagcgcaaggcgtacatttacatttgcggtgaagcaaagggt
atggcgcacgatgtcgaggccatctttggcaagatcctcgaggaggcaaagggttcggca
gaagaggccaagaaggagatcaagttgctcaaggaacgctcgaggctgcttctcgatgta
tggtcctaa

DBGET integrated database retrieval system