KEGG   Ustilago maydis: UM06281.1Help
Entry
UM06281.1         CDS       T01021                                 

Definition
hypothetical protein
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
uma  Ustilago maydis
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:uma00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:uma00670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 526 aa AA seqDB search
MTTAGATRKLKVLMAHGYTSNQFQFFKRSGAIRKACRDVVDFTFINGPLLVQPITSAGDL
DAPDVEDGKVVDETTPIEEQPRAWWRADDDGNYLDWDKSVDYINDVLAKEGPFDGIVGFS
QGGCLAGILASAFEKPDRMPGLRLPKGQGALKFAVAVSGFRSRDRLHQKLFEKPIETPVL
HVLGRADQIVDLERSQTLVDVCKNSRVELHDGGHSLPSQAPWRNFFRDFFATFTSDPYVP
NDQWKTIPGPSERPRGETPVGSGTVTPTPDATEAATTASSTSATGERDIDPSNPLRSVPK
KKANSPFLVHQKWKQEQELRRRKAAEQDSSSSSKGGKESRRKQHDGQHVTTDLTSPLKLI
VKLLRFAIMATAVAMVSGFFVAGDPLWGYRGKYTKLRTYLPYREKIFSLPELAMYNGRDP
NKPIYVAILGDVYDVTEGRRIYGPGGYYSFFSGRDASRAYVTGCFKTHLTHDVRDFDDKQ
MNDLMTWKDFYDSHERYFKVGRVVLPRIDPSIPVPEPCEDASAQKA
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgacgacggcaggtgcgactcgcaagctcaaagtgctcatggcgcacggctacacgagc
aatcaattccaattcttcaagcgatccggcgcgattcgaaaggcatgtcgagacgttgtc
gattttacattcatcaacggtccgttgctggtccagcccatcacgtcggctggcgatttg
gatgctccggatgtcgaagatggcaaggtcgtagacgagaccactccgatcgaggagcag
ccacgagcgtggtggagggccgacgatgatggcaactacctcgactgggataagtcggtc
gactacatcaacgacgtgctggccaaggagggaccctttgacggcattgtaggcttttcg
cagggcggctgtctggccggtatcctcgctagtgctttcgagaagccggaccgtatgcct
ggacttcgactgccgaaaggccagggagccttgaaatttgctgtggctgtgtcaggattc
cgcagtcgagaccggctccatcagaagctgttcgagaaacccatcgagacgcctgttctg
cacgtgctaggacgtgccgatcagatcgtggacctggaacgctcgcaaactctcgtggac
gtttgcaagaactcccgagtcgagctccatgatggcggacattcgctgccttcccaggct
ccatggcgaaactttttccgtgacttttttgccacgttcacgtcggacccctacgtcccc
aacgaccaatggaagaccattccaggaccatccgagcgaccgcgcggcgaaacgcctgtg
ggatcgggaacggtgacgccgacgcctgatgcaactgaggcggctaccacggcgtcgtca
acgtctgcgacaggtgagcgtgacatcgatccatccaaccctctgcgatcggtccctaag
aaaaaagccaattcgccctttctggtgcatcagaagtggaagcaggaacaggagctaaga
agaagaaaagcagccgaacaagactctagcagcagcagcaaaggcggaaaggaatcgcgc
agaaagcagcacgatggccaacacgtgacgacggacctcaccagtccactgaagttgatt
gtcaagctgcttcgtttcgccattatggcgacggcggtggcaatggtctctggcttcttt
gtcgctggcgatccgctttggggctatcgtggcaagtatacaaagctgaggacgtacttg
ccctaccgagaaaagattttttcgcttccagaactggccatgtacaacggtcgtgatccg
aacaagcccatctatgttgccatcctcggtgatgtttacgacgtcactgaaggacgacgc
atttatgggcctggtgggtactattcctttttcagcggaagagatgctagccgtgcgtac
gtgacgggctgcttcaagacgcatttgacgcacgacgtacgtgatttcgacgacaagcag
atgaatgatctgatgacgtggaaagacttctatgacagccacgaacggtactttaaagtc
ggtcgtgtggttttacctcggatcgatccgagcatccctgttcctgaaccctgtgaggat
gcgtctgcccaaaaggcctga

DBGET integrated database retrieval system