KEGG   Ustilago maydis: UM06281.1Help
Entry
UM06281.1         CDS       T01021                                 

Definition
hypothetical protein
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
uma  Ustilago maydis
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:uma00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    UM06281.1
   00670 One carbon pool by folate
    UM06281.1
Enzymes [BR:uma01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     UM06281.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 526 aa AA seqDB search
MTTAGATRKLKVLMAHGYTSNQFQFFKRSGAIRKACRDVVDFTFINGPLLVQPITSAGDL
DAPDVEDGKVVDETTPIEEQPRAWWRADDDGNYLDWDKSVDYINDVLAKEGPFDGIVGFS
QGGCLAGILASAFEKPDRMPGLRLPKGQGALKFAVAVSGFRSRDRLHQKLFEKPIETPVL
HVLGRADQIVDLERSQTLVDVCKNSRVELHDGGHSLPSQAPWRNFFRDFFATFTSDPYVP
NDQWKTIPGPSERPRGETPVGSGTVTPTPDATEAATTASSTSATGERDIDPSNPLRSVPK
KKANSPFLVHQKWKQEQELRRRKAAEQDSSSSSKGGKESRRKQHDGQHVTTDLTSPLKLI
VKLLRFAIMATAVAMVSGFFVAGDPLWGYRGKYTKLRTYLPYREKIFSLPELAMYNGRDP
NKPIYVAILGDVYDVTEGRRIYGPGGYYSFFSGRDASRAYVTGCFKTHLTHDVRDFDDKQ
MNDLMTWKDFYDSHERYFKVGRVVLPRIDPSIPVPEPCEDASAQKA
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgacgacggcaggtgcgactcgcaagctcaaagtgctcatggcgcacggctacacgagc
aatcaattccaattcttcaagcgatccggcgcgattcgaaaggcatgtcgagacgttgtc
gattttacattcatcaacggtccgttgctggtccagcccatcacgtcggctggcgatttg
gatgctccggatgtcgaagatggcaaggtcgtagacgagaccactccgatcgaggagcag
ccacgagcgtggtggagggccgacgatgatggcaactacctcgactgggataagtcggtc
gactacatcaacgacgtgctggccaaggagggaccctttgacggcattgtaggcttttcg
cagggcggctgtctggccggtatcctcgctagtgctttcgagaagccggaccgtatgcct
ggacttcgactgccgaaaggccagggagccttgaaatttgctgtggctgtgtcaggattc
cgcagtcgagaccggctccatcagaagctgttcgagaaacccatcgagacgcctgttctg
cacgtgctaggacgtgccgatcagatcgtggacctggaacgctcgcaaactctcgtggac
gtttgcaagaactcccgagtcgagctccatgatggcggacattcgctgccttcccaggct
ccatggcgaaactttttccgtgacttttttgccacgttcacgtcggacccctacgtcccc
aacgaccaatggaagaccattccaggaccatccgagcgaccgcgcggcgaaacgcctgtg
ggatcgggaacggtgacgccgacgcctgatgcaactgaggcggctaccacggcgtcgtca
acgtctgcgacaggtgagcgtgacatcgatccatccaaccctctgcgatcggtccctaag
aaaaaagccaattcgccctttctggtgcatcagaagtggaagcaggaacaggagctaaga
agaagaaaagcagccgaacaagactctagcagcagcagcaaaggcggaaaggaatcgcgc
agaaagcagcacgatggccaacacgtgacgacggacctcaccagtccactgaagttgatt
gtcaagctgcttcgtttcgccattatggcgacggcggtggcaatggtctctggcttcttt
gtcgctggcgatccgctttggggctatcgtggcaagtatacaaagctgaggacgtacttg
ccctaccgagaaaagattttttcgcttccagaactggccatgtacaacggtcgtgatccg
aacaagcccatctatgttgccatcctcggtgatgtttacgacgtcactgaaggacgacgc
atttatgggcctggtgggtactattcctttttcagcggaagagatgctagccgtgcgtac
gtgacgggctgcttcaagacgcatttgacgcacgacgtacgtgatttcgacgacaagcag
atgaatgatctgatgacgtggaaagacttctatgacagccacgaacggtactttaaagtc
ggtcgtgtggttttacctcggatcgatccgagcatccctgttcctgaaccctgtgaggat
gcgtctgcccaaaaggcctga

DBGET integrated database retrieval system