KEGG   Ustilago maydis: UM06296.1Help
Entry
UM06296.1         CDS       T01021                                 

Definition
hypothetical protein
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
uma  Ustilago maydis
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:uma00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    UM06296.1
  Replication and repair
   03420 Nucleotide excision repair
    UM06296.1
Transcription machinery [BR:uma03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     UM06296.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 491 aa AA seqDB search
MASQRHTPGPGQGLTSTAKGGTNTALAISEHSRAAGIGAETIDDFLDRQPRSVLIRLYQK
PASCLAIFRLLPMMARQLIMHMLFLDVPLAADDFLAWIKKEVKNEFDAAVDKLSRLSIIQ
LKASAGKQMLLLNAGFTEGMRRALTGGGKHRSFGVPCDTEDKNAVDVAFLDQYARTKWET
ILHYMVGSDNSSTPREPVLYLLRRSNLMQPRTASSSNGGLNITSRGFQFLLEDVNTQLWD
LLLQYLDMAEERNMDLVEVLAFLFMLGSLELGRDYSTEELPETQLHMLEDFRDYGLVYQR
KASSRRFYPTRLATTLTSSAAVPLLSSNGTEQEERGYIILETNYRLYAYTSNPLRVAVLS
LFVTIKARFPNLVVGSITRDSVKSALANGITAEQIITYLTHHAHLQMHRNDPLLPVTVSD
QIRLWEREKNRVQQNLGSLFTDFTSQFDFEEVRNYAKQLGVLVWQDEEKRRFFVDEAGNE
PVRDYIRRRRA
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggcgagccagcgacatacaccagggcctggccaaggactcacatccacagccaaagga
ggtaccaacactgcgcttgccatttctgaacactcgagagcagctggcattggagctgaa
accatcgacgactttttggaccggcaacctcgatccgtgctcatccgtctctaccagaaa
ccagcatcctgtctcgctatcttccgactgctccccatgatggcgcgccagctcatcatg
cacatgctctttctggatgttccgctggcagcagacgacttcttggcgtggatcaaaaag
gaggtaaaaaatgagtttgatgctgctgtcgacaagctctcccgtctgtccatcatacag
ctcaaggcatcggcgggcaagcagatgctactgctcaatgccggcttcactgaaggaatg
cgaagagccttgacgggcggaggaaaacatcgatcttttggtgtaccctgtgatacagaa
gacaagaatgcggtggatgtggcttttctggatcagtatgctcgcacaaagtgggaaacg
attctccattacatggttggcagcgataactcgagcactcctcgtgagcccgtgctctac
cttttacgtagaagcaatctcatgcagcctagaaccgcctcgagctcgaatggaggactc
aacatcactagccgtggattccagtttttgttagaagacgtcaacacacagctgtgggat
ttgctcttgcaatacctcgatatggccgaggagcgaaacatggatctggtcgaggtgctc
gcctttctcttcatgctgggcagcttggagctcggcagagattactcgacagaggagttg
cccgaaacacagctgcacatgctcgaagatttccgcgactacggtcttgtctatcaacgc
aaagcgtcgagccgacgcttttaccctacacgccttgccaccaccctcacttcgtccgct
gctgtacctctgctgtcgagcaacggaacagagcaggaagaacgaggctacatcatcctc
gagaccaactaccgcctttacgcgtatacttcgaacccgctccgagtcgcagtgctgtcg
ctgtttgttaccatcaaggccaggttcccgaatttggtcgttggatccattacgcgtgat
tcggtcaagtcggccctggcaaacggcatcaccgccgaacagatcatcacgtatctcacg
catcacgcacacctccagatgcatcgtaacgatcctctacttcctgtcaccgtgtcggat
cagatcagattatgggagcgcgaaaagaaccgagtccagcaaaacttgggttcgctcttc
accgactttacaagtcaattcgactttgaagaggtgcgcaactacgccaagcagctcggt
gtgctggtatggcaggatgaggagaagagaagattcttcgtggacgaagcgggcaacgaa
cctgtgcgagactatattcgaagaagaagagcgtag

DBGET integrated database retrieval system