KEGG   Ustilago maydis: UM06377.1Help
Entry
UM06377.1         CDS       T01021                                 

Definition
hypothetical protein
Orthology
K03259  
translation initiation factor 4E
Organism
uma  Ustilago maydis
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:uma00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    UM06377.1
Translation factors [BR:uma03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    UM06377.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
23
AA seq 280 aa AA seqDB search
MSATTDLPKRPADAAKAALDSAVHHTVNGDAVATSSEDASGASAPSNTDANANEYRTVFQ
DANNFNVKHPLYNSWTLWFDNPSQKGMASARGSKESWGDDMNKVVDFDSVEEFWGLYNNV
VPPSELPQKANYYLFKQGVKPAWEDPANTNGGKWSIQLPRDKTRAQIDRLWLYTMLAAIG
ETLEAPFPNGAAPPSSSAEDELVTGVIMSARANFYRIAIWTRKAEDTDELAAKLLDIGKQ
FKVNVLGYEIDAKIGAGLTSDVEFQSHKESEKKKGKKTIV
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcaactaccgaccttccaaagcgaccggcagatgccgccaaggctgccctggac
tcggctgtccaccacaccgtcaatggtgacgctgtagccacctcttcggaagacgcctcc
ggtgctagcgcgccatcaaatacggatgccaatgctaacgagtatcgcaccgtcttccag
gacgccaacaacttcaacgtcaagcacccgctgtacaactcgtggacgttgtggtttgac
aacccctcccaaaagggcatggcatctgcgcgtggaagcaaggagagctggggggacgac
atgaacaaggtggtcgactttgacagtgtggaagagttctggggtctttacaacaacgtg
gtgccaccttcggaattgccacaaaaggccaactactacctcttcaagcaaggtgtcaag
cctgcttgggaagaccctgccaacaccaacggtggtaaatggagcatccaactgccacgc
gataagactcgcgcacagatcgaccgattgtggctctacaccatgctcgccgccatcggt
gagacgctcgaggcaccgtttccgaatggcgccgctcctcccagcagcagtgccgaggac
gagctggtgacgggtgttatcatgtctgcgcgtgctaacttttaccgcatcgcgatctgg
acaagaaaagccgaggacaccgacgagttggcagccaagctgctcgacattggcaagcag
ttcaaggtgaatgtgttgggctacgagatcgatgccaagatcggcgccggtctgacgagc
gatgtcgagttccagagccacaaggagagcgagaagaagaagggcaaaaagaccatcgtt
taa

DBGET integrated database retrieval system