KEGG   Ustilago maydis: UM06446.1Help
Entry
UM06446.1         CDS       T01021                                 

Definition
hypothetical protein
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
uma  Ustilago maydis
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:uma00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    UM06446.1
Enzymes [BR:uma01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     UM06446.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
23
AA seq 123 aa AA seqDB search
MVIVKDIEIFSLCEHHMVPFTGKIHIGYIPNRLVIGLSKLARIAETFARRLQVQERLTKQ
VALALDEALRPQGVAVVVECEHLCMAMRGVQKPGATTVTSCMLGVFRDRQKTREEFLSLI
NKR
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atggtgattgtcaaggatatcgagatctttagcctgtgcgaacaccacatggtgccgttc
acgggcaaaatccacattggctatattccgaatcgactagtgatcgggctgtccaagttg
gcaaggatcgccgaaacgtttgcgaggagattgcaggtgcaggagagattgaccaagcag
gtggcgttggcgttggacgaggcattgcgtccgcagggtgtagctgtggtcgtcgagtgc
gagcacctgtgcatggccatgaggggtgtacagaaacccggcgcgacaaccgtcacgagc
tgcatgctgggcgtctttagagatcgacaaaagaccagagaggagttcctctcgctcatc
aacaagaggtag

DBGET integrated database retrieval system