KEGG   Ursus maritimus (polar bear): 103669484Help
Entry
103669484         CDS       T03271                                 

Gene name
MGLL
Definition
(RefSeq) monoglyceride lipase
  KO
K01054  
acylglycerol lipase [EC:3.1.1.23]
Organism
umr  Ursus maritimus (polar bear)
Pathway
Glycerolipid metabolism
Metabolic pathways
Thermogenesis
Retrograde endocannabinoid signaling
Regulation of lipolysis in adipocytes
Module
Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:umr00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    103669484 (MGLL)
 Organismal Systems
  Endocrine system
   04923 Regulation of lipolysis in adipocyte
    103669484 (MGLL)
  Nervous system
   04723 Retrograde endocannabinoid signaling
    103669484 (MGLL)
  Environmental adaptation
   04714 Thermogenesis
    103669484 (MGLL)
Enzymes [BR:umr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     103669484 (MGLL)
Peptidases [BR:umr01002]
 Serine Peptidases
  Family S33
   103669484 (MGLL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Un
AA seq 313 aa AA seqDB search
METGLEDPFRMPEEGSPRRTPQSVPYQDLPHLVNADGQYLFCRSWKPTGTPRALIFVSHG
AGEHCGRYDELAQMLVGLGLLVFAHDHVGHGQSEGERMVVSDFHVFIRDVLQHVDTMQKD
YPGLPVFLLGHSMGGAIAILTAAERPSHFSGMVLISPLVLANPESATTFKVFAAKVLNLV
LPNMSLGPIDSSVLSRNKTEVDLYNSDPLICHAGLKVCFGNQLLNAVTRVERALPKLTLP
FLLLQGSADRLCDSKGAYLLMESAKSQDKTLKIYEGAYHVLHKELPEVTNSVFREINMWI
SQRTGAAGTGSPP
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggaaacaggacttgaagatcctttcagaatgccggaggaaggttctcccaggcggacc
ccgcagagcgttccgtaccaggacctccctcacctggtcaatgccgacggacagtacctg
ttctgcaggtcctggaaaccgacgggcacacccagggccctcatctttgtgtctcatgga
gccggggagcactgcggtcgctatgacgagctggctcagatgctggtggggctggggctg
ctggtattcgcccacgaccatgttggccatggacagagcgaaggggagaggatggtagtg
tctgacttccacgttttcatcagggacgtgttacagcacgtggataccatgcagaaagac
tacccagggcttcccgtcttccttctgggccactccatgggaggtgccatcgccatcctc
acggccgcggagaggccaagccacttctccggcatggtcctcatttcgcctttggttctt
gccaatcctgagtctgcaacaactttcaaggtctttgctgcgaaagttctcaaccttgtc
ctgccaaacatgtccctgggcccaattgactccagcgtgctctctcggaataagacagag
gtggacctttataactcggacccactcatctgccacgcgggtctgaaggtgtgcttcggc
aaccagctgctcaacgcggtgacgcgggtggagcgggccctccccaagctgaccttgccc
ttcctgctgctccagggctctgccgaccgcctttgcgacagcaaaggggcctacctgctc
atggagtccgccaagagccaggacaagacactcaagatttacgaaggtgcctaccacgtt
ctccacaaagagcttcctgaagtaaccaactccgtcttccgtgaaataaacatgtggatc
tcccaaaggacaggggcggcgggaacagggtccccaccctga

DBGET integrated database retrieval system