
Database: UniProt
Entry: A2A2Y4
LinkDB: A2A2Y4
Original site: A2A2Y4 
ID   FRMD3_HUMAN             Reviewed;         597 AA.
AC   A2A2Y4; A8MQB0; B4DN14; Q53EP2; Q5JV59; Q5VZA1; Q86WP8; Q8IZ44;
AC   Q8N3Y5; Q8N9L2;
DT   05-FEB-2008, integrated into UniProtKB/Swiss-Prot.
DT   20-FEB-2007, sequence version 1.
DT   22-NOV-2017, entry version 101.
DE   RecName: Full=FERM domain-containing protein 3;
DE   AltName: Full=Band 4.1-like protein 4O;
DE   AltName: Full=Ovary type protein 4.1;
DE            Short=4.1O;
GN   Name=FRMD3; Synonyms=EPB41L4O;
OS   Homo sapiens (Human).
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
OC   Catarrhini; Hominidae; Homo.
OX   NCBI_TaxID=9606;
RN   [1]
RC   TISSUE=Fetal brain;
RX   PubMed=12601556; DOI=10.1007/s100380300015;
RA   Ni X., Ji C., Cao G., Cheng H., Guo L., Gu S., Ying K., Zhao R.C.,
RA   Mao Y.;
RT   "Molecular cloning and characterization of the protein 4.1O gene, a
RT   novel member of the protein 4.1 family with focal expression in
RT   ovary.";
RL   J. Hum. Genet. 48:101-106(2003).
RN   [2]
RC   TISSUE=Cerebellum;
RX   PubMed=14702039; DOI=10.1038/ng1285;
RA   Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
RA   Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
RA   Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
RA   Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
RA   Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A.,
RA   Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M.,
RA   Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y.,
RA   Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M.,
RA   Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K.,
RA   Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S.,
RA   Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J.,
RA   Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y.,
RA   Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N.,
RA   Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
RA   Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
RA   Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
RA   Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
RA   Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
RA   Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y.,
RA   Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T.,
RA   Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y.,
RA   Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S.,
RA   Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T.,
RA   Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M.,
RA   Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T.,
RA   Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K.,
RA   Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R.,
RA   Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.;
RT   "Complete sequencing and characterization of 21,243 full-length human
RT   cDNAs.";
RL   Nat. Genet. 36:40-45(2004).
RN   [3]
RX   PubMed=17974005; DOI=10.1186/1471-2164-8-399;
RA   Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U.,
RA   Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H.,
RA   Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K.,
RA   Ottenwaelder B., Poustka A., Wiemann S., Schupp I.;
RT   "The full-ORF clone resource of the German cDNA consortium.";
RL   BMC Genomics 8:399-399(2007).
RN   [4]
RX   PubMed=15164053; DOI=10.1038/nature02465;
RA   Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E.,
RA   Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C.,
RA   Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S.,
RA   Babbage A.K., Babbage S., Bagguley C.L., Bailey J., Banerjee R.,
RA   Barker D.J., Barlow K.F., Bates K., Beasley H., Beasley O., Bird C.P.,
RA   Bray-Allen S., Brown A.J., Brown J.Y., Burford D., Burrill W.,
RA   Burton J., Carder C., Carter N.P., Chapman J.C., Chen Y., Clarke G.,
RA   Clark S.Y., Clee C.M., Clegg S., Collier R.E., Corby N., Crosier M.,
RA   Cummings A.T., Davies J., Dhami P., Dunn M., Dutta I., Dyer L.W.,
RA   Earthrowl M.E., Faulkner L., Fleming C.J., Frankish A.,
RA   Frankland J.A., French L., Fricker D.G., Garner P., Garnett J.,
RA   Ghori J., Gilbert J.G.R., Glison C., Grafham D.V., Gribble S.,
RA   Griffiths C., Griffiths-Jones S., Grocock R., Guy J., Hall R.E.,
RA   Hammond S., Harley J.L., Harrison E.S.I., Hart E.A., Heath P.D.,
RA   Henderson C.D., Hopkins B.L., Howard P.J., Howden P.J., Huckle E.,
RA   Johnson C., Johnson D., Joy A.A., Kay M., Keenan S., Kershaw J.K.,
RA   Kimberley A.M., King A., Knights A., Laird G.K., Langford C.,
RA   Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C., Lloyd D.M.,
RA   Lovell J., Martin S., Mashreghi-Mohammadi M., Matthews L., McLaren S.,
RA   McLay K.E., McMurray A., Milne S., Nickerson T., Nisbett J.,
RA   Nordsiek G., Pearce A.V., Peck A.I., Porter K.M., Pandian R.,
RA   Pelan S., Phillimore B., Povey S., Ramsey Y., Rand V., Scharfe M.,
RA   Sehra H.K., Shownkeen R., Sims S.K., Skuce C.D., Smith M.,
RA   Steward C.A., Swarbreck D., Sycamore N., Tester J., Thorpe A.,
RA   Tracey A., Tromans A., Thomas D.W., Wall M., Wallis J.M., West A.P.,
RA   Whitehead S.L., Willey D.L., Williams S.A., Wilming L., Wray P.W.,
RA   Young L., Ashurst J.L., Coulson A., Blocker H., Durbin R.M.,
RA   Sulston J.E., Hubbard T., Jackson M.J., Bentley D.R., Beck S.,
RA   Rogers J., Dunham I.;
RT   "DNA sequence and analysis of human chromosome 9.";
RL   Nature 429:369-374(2004).
RN   [5]
RA   Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L.,
RA   Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R.,
RA   Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V.,
RA   Hannenhalli S., Turner R., Yooseph S., Lu F., Nusskern D.R.,
RA   Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H.,
RA   Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G.,
RA   Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W.,
RA   Venter J.C.;
RL   Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases.
RN   [6]
RC   TISSUE=Brain, and Placenta;
RX   PubMed=15489334; DOI=10.1101/gr.2596504;
RG   The MGC Project Team;
RT   "The status, quality, and expansion of the NIH full-length cDNA
RT   project: the Mammalian Gene Collection (MGC).";
RL   Genome Res. 14:2121-2127(2004).
RN   [7]
RC   TISSUE=Kidney;
RA   Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S.;
RL   Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases.
RN   [8]
RX   PubMed=17260017; DOI=10.1038/sj.onc.1210225;
RA   Haase D., Meister M., Muley T., Hess J., Teurich S., Schnabel P.,
RA   Hartenstein B., Angel P.;
RT   "FRMD3, a novel putative tumour suppressor in NSCLC.";
RL   Oncogene 26:4464-4468(2007).
CC   -!- FUNCTION: Putative tumor suppressor gene that may be implicated in
CC       the origin and progression of lung cancer.
CC       {ECO:0000269|PubMed:17260017}.
CC   -!- SUBCELLULAR LOCATION: Membrane {ECO:0000305}; Single-pass membrane
CC       protein {ECO:0000305}.
CC       Event=Alternative splicing; Named isoforms=5;
CC       Name=1;
CC         IsoId=A2A2Y4-1; Sequence=Displayed;
CC       Name=2;
CC         IsoId=A2A2Y4-2; Sequence=VSP_031167;
CC       Name=3;
CC         IsoId=A2A2Y4-3; Sequence=VSP_031163, VSP_031165, VSP_031167;
CC       Name=4;
CC         IsoId=A2A2Y4-4; Sequence=VSP_031162, VSP_031166, VSP_031167;
CC         Note=No experimental confirmation available.;
CC       Name=5;
CC         IsoId=A2A2Y4-5; Sequence=VSP_031164;
CC   -!- TISSUE SPECIFICITY: Ovary-specific. {ECO:0000269|PubMed:12601556}.
CC   -!- DEVELOPMENTAL STAGE: Expressed in skeletal muscle, lower levels in
CC       thymus and brain. {ECO:0000269|PubMed:12601556}.
CC       Sequence=BAC04321.1; Type=Erroneous initiation; Evidence={ECO:0000305};
CC       Sequence=EAW62650.1; Type=Erroneous initiation; Evidence={ECO:0000305};
DR   EMBL; AY137774; AAN52119.1; -; mRNA.
DR   EMBL; AK094281; BAC04321.1; ALT_INIT; mRNA.
DR   EMBL; AK297722; BAG60076.1; -; mRNA.
DR   EMBL; EF560742; ABQ59052.1; -; mRNA.
DR   EMBL; AL161786; -; NOT_ANNOTATED_CDS; Genomic_DNA.
DR   EMBL; AL137847; -; NOT_ANNOTATED_CDS; Genomic_DNA.
DR   EMBL; AL450026; -; NOT_ANNOTATED_CDS; Genomic_DNA.
DR   EMBL; CH471089; EAW62647.1; -; Genomic_DNA.
DR   EMBL; CH471089; EAW62649.1; -; Genomic_DNA.
DR   EMBL; CH471089; EAW62650.1; ALT_INIT; Genomic_DNA.
DR   EMBL; CH471089; EAW62651.1; -; Genomic_DNA.
DR   EMBL; BC023560; AAH23560.1; -; mRNA.
DR   EMBL; BC037253; AAH37253.1; -; mRNA.
DR   EMBL; AK223597; BAD97317.1; -; mRNA.
DR   CCDS; CCDS43840.1; -. [A2A2Y4-1]
DR   CCDS; CCDS59131.1; -. [A2A2Y4-4]
DR   CCDS; CCDS59132.1; -. [A2A2Y4-3]
DR   CCDS; CCDS59133.1; -. [A2A2Y4-2]
DR   CCDS; CCDS75852.1; -. [A2A2Y4-5]
DR   RefSeq; NP_001231888.1; NM_001244959.1. [A2A2Y4-2]
DR   RefSeq; NP_001231889.1; NM_001244960.1. [A2A2Y4-5]
DR   RefSeq; NP_001231890.1; NM_001244961.1. [A2A2Y4-3]
DR   RefSeq; NP_001231891.1; NM_001244962.1. [A2A2Y4-4]
DR   RefSeq; NP_777598.3; NM_174938.5. [A2A2Y4-1]
DR   UniGene; Hs.127535; -.
DR   UniGene; Hs.743606; -.
DR   ProteinModelPortal; A2A2Y4; -.
DR   SMR; A2A2Y4; -.
DR   BioGrid; 129190; 12.
DR   IntAct; A2A2Y4; 16.
DR   STRING; 9606.ENSP00000303508; -.
DR   iPTMnet; A2A2Y4; -.
DR   PhosphoSitePlus; A2A2Y4; -.
DR   BioMuta; FRMD3; -.
DR   MaxQB; A2A2Y4; -.
DR   PaxDb; A2A2Y4; -.
DR   PRIDE; A2A2Y4; -.
DR   DNASU; 257019; -.
DR   Ensembl; ENST00000304195; ENSP00000303508; ENSG00000172159. [A2A2Y4-1]
DR   Ensembl; ENST00000328788; ENSP00000328615; ENSG00000172159. [A2A2Y4-4]
DR   Ensembl; ENST00000376434; ENSP00000365617; ENSG00000172159. [A2A2Y4-3]
DR   Ensembl; ENST00000376438; ENSP00000365621; ENSG00000172159. [A2A2Y4-2]
DR   Ensembl; ENST00000621208; ENSP00000484839; ENSG00000172159. [A2A2Y4-5]
DR   GeneID; 257019; -.
DR   KEGG; hsa:257019; -.
DR   UCSC; uc004amq.1; human. [A2A2Y4-1]
DR   CTD; 257019; -.
DR   DisGeNET; 257019; -.
DR   EuPathDB; HostDB:ENSG00000172159.15; -.
DR   GeneCards; FRMD3; -.
DR   H-InvDB; HIX0023043; -.
DR   HGNC; HGNC:24125; FRMD3.
DR   HPA; HPA017285; -.
DR   MIM; 607619; gene.
DR   neXtProt; NX_A2A2Y4; -.
DR   OpenTargets; ENSG00000172159; -.
DR   PharmGKB; PA134903920; -.
DR   eggNOG; KOG3530; Eukaryota.
DR   GeneTree; ENSGT00760000118823; -.
DR   HOVERGEN; HBG057180; -.
DR   InParanoid; A2A2Y4; -.
DR   OrthoDB; EOG091G06EA; -.
DR   PhylomeDB; A2A2Y4; -.
DR   TreeFam; TF343477; -.
DR   ChiTaRS; FRMD3; human.
DR   GenomeRNAi; 257019; -.
DR   PRO; PR:A2A2Y4; -.
DR   Proteomes; UP000005640; Chromosome 9.
DR   Bgee; ENSG00000172159; -.
DR   ExpressionAtlas; A2A2Y4; baseline and differential.
DR   Genevisible; A2A2Y4; HS.
DR   GO; GO:0005856; C:cytoskeleton; IBA:GO_Central.
DR   GO; GO:0016021; C:integral component of membrane; IEA:UniProtKB-KW.
DR   GO; GO:0008092; F:cytoskeletal protein binding; IEA:InterPro.
DR   GO; GO:0005200; F:structural constituent of cytoskeleton; IBA:GO_Central.
DR   GO; GO:0031032; P:actomyosin structure organization; IBA:GO_Central.
DR   CDD; cd14473; FERM_B-lobe; 1.
DR   Gene3D;; -; 1.
DR   Gene3D;; -; 1.
DR   InterPro; IPR019749; Band_41_domain.
DR   InterPro; IPR000798; Ez/rad/moesin-like.
DR   InterPro; IPR014847; FERM-adjacent.
DR   InterPro; IPR014352; FERM/acyl-CoA-bd_prot_sf.
DR   InterPro; IPR035963; FERM_2.
DR   InterPro; IPR019748; FERM_central.
DR   InterPro; IPR019747; FERM_CS.
DR   InterPro; IPR000299; FERM_domain.
DR   InterPro; IPR018979; FERM_N.
DR   InterPro; IPR018980; FERM_PH-like_C.
DR   InterPro; IPR011993; PH-like_dom_sf.
DR   InterPro; IPR029071; Ubiquitin-like_domsf.
DR   Pfam; PF08736; FA; 1.
DR   Pfam; PF09380; FERM_C; 1.
DR   Pfam; PF00373; FERM_M; 1.
DR   Pfam; PF09379; FERM_N; 1.
DR   PRINTS; PR00935; BAND41.
DR   SMART; SM00295; B41; 1.
DR   SMART; SM01195; FA; 1.
DR   SMART; SM01196; FERM_C; 1.
DR   SUPFAM; SSF47031; SSF47031; 1.
DR   SUPFAM; SSF50729; SSF50729; 1.
DR   SUPFAM; SSF54236; SSF54236; 1.
DR   PROSITE; PS00660; FERM_1; 1.
DR   PROSITE; PS50057; FERM_3; 1.
PE   2: Evidence at transcript level;
KW   Alternative splicing; Complete proteome; Membrane; Polymorphism;
KW   Reference proteome; Transmembrane; Transmembrane helix.
FT   CHAIN         1    597       FERM domain-containing protein 3.
FT                                /FTId=PRO_0000318098.
FT   TRANSMEM    531    551       Helical. {ECO:0000255}.
FT   DOMAIN       32    312       FERM. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00084}.
FT   VAR_SEQ       1    344       Missing (in isoform 4).
FT                                {ECO:0000303|PubMed:15489334}.
FT                                /FTId=VSP_031162.
FT   VAR_SEQ       1    194       Missing (in isoform 3).
FT                                {ECO:0000303|PubMed:15489334}.
FT                                /FTId=VSP_031163.
FT                                SEISCHIQ -> MQLSK (in isoform 5).
FT                                {ECO:0000303|PubMed:12601556}.
FT                                /FTId=VSP_031164.
FT   VAR_SEQ     195    198       KNEL -> MVFR (in isoform 3).
FT                                {ECO:0000303|PubMed:15489334}.
FT                                /FTId=VSP_031165.
FT                                RSLQLHMVNHCNSNVFVRLLRLGSKVTARNT (in
FT                                isoform 4).
FT                                {ECO:0000303|PubMed:15489334}.
FT                                /FTId=VSP_031166.
FT                                LGCS -> VSMQ (in isoform 2, isoform 3 and
FT                                isoform 4). {ECO:0000303|PubMed:14702039,
FT                                ECO:0000303|PubMed:15489334}.
FT                                /FTId=VSP_031167.
FT   VARIANT     485    485       D -> Y (in dbSNP:rs4877747).
FT                                /FTId=VAR_048366.
FT   CONFLICT    248    248       Q -> R (in Ref. 1; AAN52119).
FT                                {ECO:0000305}.
FT   CONFLICT    554    554       I -> V (in Ref. 1; AAN52119).
FT                                {ECO:0000305}.
SQ   SEQUENCE   597 AA;  68772 MW;  0B11ABBDDDE0AE67 CRC64;
DBGET integrated database retrieval system