GenomeNet

Database: UniProt
Entry: A2A2Y4
LinkDB: A2A2Y4
Original site: A2A2Y4 
ID   FRMD3_HUMAN             Reviewed;         597 AA.
AC   A2A2Y4; A8MQB0; B4DN14; Q53EP2; Q5JV59; Q5VZA1; Q86WP8; Q8IZ44;
AC   Q8N3Y5; Q8N9L2;
DT   05-FEB-2008, integrated into UniProtKB/Swiss-Prot.
DT   20-FEB-2007, sequence version 1.
DT   29-OCT-2014, entry version 75.
DE   RecName: Full=FERM domain-containing protein 3;
DE   AltName: Full=Band 4.1-like protein 4O;
DE   AltName: Full=Ovary type protein 4.1;
DE            Short=4.1O;
GN   Name=FRMD3; Synonyms=EPB41L4O;
OS   Homo sapiens (Human).
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
OC   Catarrhini; Hominidae; Homo.
OX   NCBI_TaxID=9606;
RN   [1]
RP   NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5), TISSUE SPECIFICITY, AND
RP   DEVELOPMENTAL STAGE.
RC   TISSUE=Fetal brain;
RX   PubMed=12601556; DOI=10.1007/s100380300015;
RA   Ni X., Ji C., Cao G., Cheng H., Guo L., Gu S., Ying K., Zhao R.C.,
RA   Mao Y.;
RT   "Molecular cloning and characterization of the protein 4.1O gene, a
RT   novel member of the protein 4.1 family with focal expression in
RT   ovary.";
RL   J. Hum. Genet. 48:101-106(2003).
RN   [2]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), AND NUCLEOTIDE
RP   SEQUENCE [LARGE SCALE MRNA] OF 34-597 (ISOFORM 2).
RC   TISSUE=Cerebellum;
RX   PubMed=14702039; DOI=10.1038/ng1285;
RA   Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
RA   Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
RA   Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
RA   Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
RA   Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A.,
RA   Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M.,
RA   Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y.,
RA   Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M.,
RA   Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K.,
RA   Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S.,
RA   Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J.,
RA   Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y.,
RA   Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N.,
RA   Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
RA   Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
RA   Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
RA   Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
RA   Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
RA   Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y.,
RA   Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T.,
RA   Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y.,
RA   Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S.,
RA   Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T.,
RA   Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M.,
RA   Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T.,
RA   Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K.,
RA   Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R.,
RA   Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.;
RT   "Complete sequencing and characterization of 21,243 full-length human
RT   cDNAs.";
RL   Nat. Genet. 36:40-45(2004).
RN   [3]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
RX   PubMed=17974005; DOI=10.1186/1471-2164-8-399;
RA   Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U.,
RA   Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H.,
RA   Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K.,
RA   Ottenwaelder B., Poustka A., Wiemann S., Schupp I.;
RT   "The full-ORF clone resource of the German cDNA consortium.";
RL   BMC Genomics 8:399-399(2007).
RN   [4]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
RX   PubMed=15164053; DOI=10.1038/nature02465;
RA   Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E.,
RA   Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C.,
RA   Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S.,
RA   Babbage A.K., Babbage S., Bagguley C.L., Bailey J., Banerjee R.,
RA   Barker D.J., Barlow K.F., Bates K., Beasley H., Beasley O., Bird C.P.,
RA   Bray-Allen S., Brown A.J., Brown J.Y., Burford D., Burrill W.,
RA   Burton J., Carder C., Carter N.P., Chapman J.C., Chen Y., Clarke G.,
RA   Clark S.Y., Clee C.M., Clegg S., Collier R.E., Corby N., Crosier M.,
RA   Cummings A.T., Davies J., Dhami P., Dunn M., Dutta I., Dyer L.W.,
RA   Earthrowl M.E., Faulkner L., Fleming C.J., Frankish A.,
RA   Frankland J.A., French L., Fricker D.G., Garner P., Garnett J.,
RA   Ghori J., Gilbert J.G.R., Glison C., Grafham D.V., Gribble S.,
RA   Griffiths C., Griffiths-Jones S., Grocock R., Guy J., Hall R.E.,
RA   Hammond S., Harley J.L., Harrison E.S.I., Hart E.A., Heath P.D.,
RA   Henderson C.D., Hopkins B.L., Howard P.J., Howden P.J., Huckle E.,
RA   Johnson C., Johnson D., Joy A.A., Kay M., Keenan S., Kershaw J.K.,
RA   Kimberley A.M., King A., Knights A., Laird G.K., Langford C.,
RA   Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C., Lloyd D.M.,
RA   Lovell J., Martin S., Mashreghi-Mohammadi M., Matthews L., McLaren S.,
RA   McLay K.E., McMurray A., Milne S., Nickerson T., Nisbett J.,
RA   Nordsiek G., Pearce A.V., Peck A.I., Porter K.M., Pandian R.,
RA   Pelan S., Phillimore B., Povey S., Ramsey Y., Rand V., Scharfe M.,
RA   Sehra H.K., Shownkeen R., Sims S.K., Skuce C.D., Smith M.,
RA   Steward C.A., Swarbreck D., Sycamore N., Tester J., Thorpe A.,
RA   Tracey A., Tromans A., Thomas D.W., Wall M., Wallis J.M., West A.P.,
RA   Whitehead S.L., Willey D.L., Williams S.A., Wilming L., Wray P.W.,
RA   Young L., Ashurst J.L., Coulson A., Blocker H., Durbin R.M.,
RA   Sulston J.E., Hubbard T., Jackson M.J., Bentley D.R., Beck S.,
RA   Rogers J., Dunham I.;
RT   "DNA sequence and analysis of human chromosome 9.";
RL   Nature 429:369-374(2004).
RN   [5]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
RA   Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L.,
RA   Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R.,
RA   Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V.,
RA   Hannenhalli S., Turner R., Yooseph S., Lu F., Nusskern D.R.,
RA   Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H.,
RA   Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G.,
RA   Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W.,
RA   Venter J.C.;
RL   Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases.
RN   [6]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 4).
RC   TISSUE=Brain, and Placenta;
RX   PubMed=15489334; DOI=10.1101/gr.2596504;
RG   The MGC Project Team;
RT   "The status, quality, and expansion of the NIH full-length cDNA
RT   project: the Mammalian Gene Collection (MGC).";
RL   Genome Res. 14:2121-2127(2004).
RN   [7]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 17-597 (ISOFORM 1).
RC   TISSUE=Kidney;
RA   Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S.;
RL   Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases.
RN   [8]
RP   FUNCTION.
RX   PubMed=17260017; DOI=10.1038/sj.onc.1210225;
RA   Haase D., Meister M., Muley T., Hess J., Teurich S., Schnabel P.,
RA   Hartenstein B., Angel P.;
RT   "FRMD3, a novel putative tumour suppressor in NSCLC.";
RL   Oncogene 26:4464-4468(2007).
CC   -!- FUNCTION: Putative tumor suppressor gene that may be implicated in
CC       the origin and progression of lung cancer.
CC       {ECO:0000269|PubMed:17260017}.
CC   -!- SUBCELLULAR LOCATION: Membrane {ECO:0000305}; Single-pass membrane
CC       protein {ECO:0000305}.
CC   -!- ALTERNATIVE PRODUCTS:
CC       Event=Alternative splicing; Named isoforms=5;
CC       Name=1;
CC         IsoId=A2A2Y4-1; Sequence=Displayed;
CC       Name=2;
CC         IsoId=A2A2Y4-2; Sequence=VSP_031167;
CC       Name=3;
CC         IsoId=A2A2Y4-3; Sequence=VSP_031163, VSP_031165, VSP_031167;
CC       Name=4;
CC         IsoId=A2A2Y4-4; Sequence=VSP_031162, VSP_031166, VSP_031167;
CC         Note=No experimental confirmation available.;
CC       Name=5;
CC         IsoId=A2A2Y4-5; Sequence=VSP_031164;
CC   -!- TISSUE SPECIFICITY: Ovary-specific. {ECO:0000269|PubMed:12601556}.
CC   -!- DEVELOPMENTAL STAGE: Expressed in skeletal muscle, lower levels in
CC       thymus and brain. {ECO:0000269|PubMed:12601556}.
CC   -!- SIMILARITY: Contains 1 FERM domain. {ECO:0000255|PROSITE-
CC       ProRule:PRU00084}.
CC   -!- SEQUENCE CAUTION:
CC       Sequence=BAC04321.1; Type=Erroneous initiation; Evidence={ECO:0000305};
CC       Sequence=EAW62650.1; Type=Erroneous initiation; Evidence={ECO:0000305};
CC   -----------------------------------------------------------------------
CC   Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms
CC   Distributed under the Creative Commons Attribution-NoDerivs License
CC   -----------------------------------------------------------------------
DR   EMBL; AY137774; AAN52119.1; -; mRNA.
DR   EMBL; AK094281; BAC04321.1; ALT_INIT; mRNA.
DR   EMBL; AK297722; BAG60076.1; -; mRNA.
DR   EMBL; EF560742; ABQ59052.1; -; mRNA.
DR   EMBL; AL161786; CAH72749.1; -; Genomic_DNA.
DR   EMBL; AL137847; CAH72749.1; JOINED; Genomic_DNA.
DR   EMBL; AL161786; CAH72750.2; -; Genomic_DNA.
DR   EMBL; AL137847; CAH72750.2; JOINED; Genomic_DNA.
DR   EMBL; AL450026; CAH72750.2; JOINED; Genomic_DNA.
DR   EMBL; AL137847; CAI40734.1; -; Genomic_DNA.
DR   EMBL; AL161786; CAI40734.1; JOINED; Genomic_DNA.
DR   EMBL; AL137847; CAI40735.2; -; Genomic_DNA.
DR   EMBL; AL161786; CAI40735.2; JOINED; Genomic_DNA.
DR   EMBL; AL450026; CAI40735.2; JOINED; Genomic_DNA.
DR   EMBL; AL137847; CAI40736.1; -; Genomic_DNA.
DR   EMBL; AL161786; CAM17460.1; -; Genomic_DNA.
DR   EMBL; AL137847; CAM17460.1; JOINED; Genomic_DNA.
DR   EMBL; AL450026; CAM17460.1; JOINED; Genomic_DNA.
DR   EMBL; AL450026; CAM19643.1; -; Genomic_DNA.
DR   EMBL; AL137847; CAM19643.1; JOINED; Genomic_DNA.
DR   EMBL; AL161786; CAM19643.1; JOINED; Genomic_DNA.
DR   EMBL; AL450026; CAM19644.1; -; Genomic_DNA.
DR   EMBL; AL137847; CAM19644.1; JOINED; Genomic_DNA.
DR   EMBL; AL161786; CAM19644.1; JOINED; Genomic_DNA.
DR   EMBL; AL137847; CAM19673.1; -; Genomic_DNA.
DR   EMBL; AL161786; CAM19673.1; JOINED; Genomic_DNA.
DR   EMBL; AL450026; CAM19673.1; JOINED; Genomic_DNA.
DR   EMBL; CH471089; EAW62647.1; -; Genomic_DNA.
DR   EMBL; CH471089; EAW62649.1; -; Genomic_DNA.
DR   EMBL; CH471089; EAW62650.1; ALT_INIT; Genomic_DNA.
DR   EMBL; CH471089; EAW62651.1; -; Genomic_DNA.
DR   EMBL; BC023560; AAH23560.1; -; mRNA.
DR   EMBL; BC037253; AAH37253.1; -; mRNA.
DR   EMBL; AK223597; BAD97317.1; -; mRNA.
DR   CCDS; CCDS43840.1; -. [A2A2Y4-1]
DR   CCDS; CCDS59131.1; -. [A2A2Y4-4]
DR   CCDS; CCDS59132.1; -. [A2A2Y4-3]
DR   CCDS; CCDS59133.1; -. [A2A2Y4-2]
DR   CCDS; CCDS75852.1; -. [A2A2Y4-5]
DR   RefSeq; NP_001231888.1; NM_001244959.1. [A2A2Y4-2]
DR   RefSeq; NP_001231889.1; NM_001244960.1. [A2A2Y4-5]
DR   RefSeq; NP_001231890.1; NM_001244961.1. [A2A2Y4-3]
DR   RefSeq; NP_001231891.1; NM_001244962.1. [A2A2Y4-4]
DR   RefSeq; NP_777598.3; NM_174938.5. [A2A2Y4-1]
DR   UniGene; Hs.127535; -.
DR   UniGene; Hs.743606; -.
DR   ProteinModelPortal; A2A2Y4; -.
DR   SMR; A2A2Y4; 30-309.
DR   IntAct; A2A2Y4; 3.
DR   PhosphoSite; A2A2Y4; -.
DR   MaxQB; A2A2Y4; -.
DR   PaxDb; A2A2Y4; -.
DR   PRIDE; A2A2Y4; -.
DR   DNASU; 257019; -.
DR   Ensembl; ENST00000304195; ENSP00000303508; ENSG00000172159. [A2A2Y4-1]
DR   Ensembl; ENST00000328788; ENSP00000328615; ENSG00000172159. [A2A2Y4-4]
DR   Ensembl; ENST00000376434; ENSP00000365617; ENSG00000172159. [A2A2Y4-3]
DR   Ensembl; ENST00000376438; ENSP00000365621; ENSG00000172159. [A2A2Y4-2]
DR   Ensembl; ENST00000621208; ENSP00000484839; ENSG00000172159. [A2A2Y4-5]
DR   GeneID; 257019; -.
DR   KEGG; hsa:257019; -.
DR   UCSC; uc004amq.1; human. [A2A2Y4-4]
DR   UCSC; uc004amr.1; human. [A2A2Y4-2]
DR   UCSC; uc004ams.2; human. [A2A2Y4-1]
DR   UCSC; uc022biz.1; human. [A2A2Y4-3]
DR   UCSC; uc022bja.1; human. [A2A2Y4-5]
DR   CTD; 257019; -.
DR   GeneCards; GC09M085857; -.
DR   H-InvDB; HIX0023043; -.
DR   HGNC; HGNC:24125; FRMD3.
DR   HPA; HPA017285; -.
DR   MIM; 607619; gene.
DR   neXtProt; NX_A2A2Y4; -.
DR   PharmGKB; PA134903920; -.
DR   eggNOG; NOG331698; -.
DR   GeneTree; ENSGT00760000118823; -.
DR   HOVERGEN; HBG057180; -.
DR   InParanoid; A2A2Y4; -.
DR   OMA; FLCEIRQ; -.
DR   OrthoDB; EOG7M98FW; -.
DR   PhylomeDB; A2A2Y4; -.
DR   TreeFam; TF343477; -.
DR   GenomeRNAi; 257019; -.
DR   NextBio; 92903; -.
DR   PRO; PR:A2A2Y4; -.
DR   Bgee; A2A2Y4; -.
DR   ExpressionAtlas; A2A2Y4; baseline and differential.
DR   Genevestigator; A2A2Y4; -.
DR   GO; GO:0005737; C:cytoplasm; IEA:InterPro.
DR   GO; GO:0005856; C:cytoskeleton; IEA:InterPro.
DR   GO; GO:0019898; C:extrinsic component of membrane; IEA:InterPro.
DR   GO; GO:0016021; C:integral component of membrane; IEA:UniProtKB-KW.
DR   Gene3D; 1.20.80.10; -; 1.
DR   Gene3D; 2.30.29.30; -; 1.
DR   InterPro; IPR019749; Band_41_domain.
DR   InterPro; IPR019750; Band_41_fam.
DR   InterPro; IPR000798; Ez/rad/moesin_like.
DR   InterPro; IPR014847; FERM-adjacent.
DR   InterPro; IPR014352; FERM/acyl-CoA-bd_prot_3-hlx.
DR   InterPro; IPR019748; FERM_central.
DR   InterPro; IPR019747; FERM_CS.
DR   InterPro; IPR000299; FERM_domain.
DR   InterPro; IPR018979; FERM_N.
DR   InterPro; IPR018980; FERM_PH-like_C.
DR   InterPro; IPR011993; PH_like_dom.
DR   InterPro; IPR029071; Ubiquitin-rel_dom.
DR   Pfam; PF08736; FA; 1.
DR   Pfam; PF09380; FERM_C; 1.
DR   Pfam; PF00373; FERM_M; 1.
DR   Pfam; PF09379; FERM_N; 1.
DR   PRINTS; PR00935; BAND41.
DR   PRINTS; PR00661; ERMFAMILY.
DR   SMART; SM00295; B41; 1.
DR   SUPFAM; SSF47031; SSF47031; 1.
DR   SUPFAM; SSF54236; SSF54236; 1.
DR   PROSITE; PS00660; FERM_1; 1.
DR   PROSITE; PS50057; FERM_3; 1.
PE   2: Evidence at transcript level;
KW   Alternative splicing; Complete proteome; Membrane; Polymorphism;
KW   Reference proteome; Transmembrane; Transmembrane helix.
FT   CHAIN         1    597       FERM domain-containing protein 3.
FT                                /FTId=PRO_0000318098.
FT   TRANSMEM    531    551       Helical. {ECO:0000255}.
FT   DOMAIN       32    312       FERM. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00084}.
FT   VAR_SEQ       1    344       Missing (in isoform 4).
FT                                {ECO:0000303|PubMed:15489334}.
FT                                /FTId=VSP_031162.
FT   VAR_SEQ       1    194       Missing (in isoform 3).
FT                                {ECO:0000303|PubMed:15489334}.
FT                                /FTId=VSP_031163.
FT   VAR_SEQ       1     49       MFASCHCVPRGRRTMKMIHFRSSSVKSLSQEMRCTIRLLDD
FT                                SEISCHIQ -> MQLSK (in isoform 5).
FT                                {ECO:0000303|PubMed:12601556}.
FT                                /FTId=VSP_031164.
FT   VAR_SEQ     195    198       KNEL -> MVFR (in isoform 3).
FT                                {ECO:0000303|PubMed:15489334}.
FT                                /FTId=VSP_031165.
FT   VAR_SEQ     345    398       SSKIQREPPEVHRANITQSRSSHSLNKQLIINMEPLQPLLP
FT                                SPSEQEEELPLGE -> MQAEETKGIGITSMAKCLVKIQTR
FT                                RSLQLHMVNHCNSNVFVRLLRLGSKVTARNT (in
FT                                isoform 4).
FT                                {ECO:0000303|PubMed:15489334}.
FT                                /FTId=VSP_031166.
FT   VAR_SEQ     553    597       GIDLSFLCEIRQTPEFEQFHYEYYCPLKEWVAGKVHLILYM
FT                                LGCS -> VSMQ (in isoform 2, isoform 3 and
FT                                isoform 4). {ECO:0000303|PubMed:14702039,
FT                                ECO:0000303|PubMed:15489334}.
FT                                /FTId=VSP_031167.
FT   VARIANT     485    485       D -> Y (in dbSNP:rs4877747).
FT                                /FTId=VAR_048366.
FT   CONFLICT    248    248       Q -> R (in Ref. 1; AAN52119).
FT                                {ECO:0000305}.
FT   CONFLICT    554    554       I -> V (in Ref. 1; AAN52119).
FT                                {ECO:0000305}.
SQ   SEQUENCE   597 AA;  68772 MW;  0B11ABBDDDE0AE67 CRC64;
     MFASCHCVPR GRRTMKMIHF RSSSVKSLSQ EMRCTIRLLD DSEISCHIQR ETKGQFLIDH
     ICNYYSLLEK DYFGIRYVDP EKQRHWLEPN KSIFKQMKTH PPYTMCFRVK FYPHEPLKIK
     EELTRYLLYL QIKRDIFHGR LLCSFSDAAY LGACIVQAEL GDYDPDEHPE NYISEFEIFP
     KQSQKLERKI VEIHKNELRG QSPPVAEFNL LLKAHTLETY GVDPHPCKDS TGTTTFLGFT
     AAGFVVFQGN KRIHLIKWPD VCKLKFEGKT FYVIGTQKEK KAMLAFHTST PAACKHLWKC
     GVENQAFYKY AKSSQIKTVS SSKIFFKGSR FRYSGKVAKE VVEASSKIQR EPPEVHRANI
     TQSRSSHSLN KQLIINMEPL QPLLPSPSEQ EEELPLGEGV PLPKEENISA PLISSSPVKA
     AREYEDPPSE EEDKIKEEPL TISELVYNPS ASLLPTPVDD DEIDMLFDCP SRLELEREDT
     DSFEDLEADE NAFLIAEEEE LKEARRALSW SYDILTGHIR VNPLVKSFSR LLVVGLGLLL
     FVFPLLLLLL ESGIDLSFLC EIRQTPEFEQ FHYEYYCPLK EWVAGKVHLI LYMLGCS
//
DBGET integrated database retrieval system