GenomeNet

Database: UniProt
Entry: A2A863
LinkDB: A2A863
Original site: A2A863 
ID   ITB4_MOUSE              Reviewed;        1818 AA.
AC   A2A863; A2A865; A2A866; Q6PCS0; Q8R3J1; Q91W15;
DT   07-JUL-2009, integrated into UniProtKB/Swiss-Prot.
DT   20-FEB-2007, sequence version 1.
DT   11-JUN-2014, entry version 76.
DE   RecName: Full=Integrin beta-4;
DE   AltName: CD_antigen=CD104;
DE   Flags: Precursor;
GN   Name=Itgb4;
OS   Mus musculus (Mouse).
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;
OC   Muroidea; Muridae; Murinae; Mus; Mus.
OX   NCBI_TaxID=10090;
RN   [1]
RP   NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
RX   PubMed=8359687; DOI=10.1016/0378-1119(93)90421-X;
RA   Kennel S.J., Foote L.J., Cimino L., Rizzo M.G., Chang L.Y., Sacchi A.;
RT   "Sequence of a cDNA encoding the beta 4 subunit of murine integrin.";
RL   Gene 130:209-216(1993).
RN   [2]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
RC   STRAIN=C57BL/6J;
RX   PubMed=19468303; DOI=10.1371/journal.pbio.1000112;
RA   Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S.,
RA   She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W.,
RA   Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T.,
RA   Zhou S., Teague B., Potamousis K., Churas C., Place M., Herschleb J.,
RA   Runnheim R., Forrest D., Amos-Landgraf J., Schwartz D.C., Cheng Z.,
RA   Lindblad-Toh K., Eichler E.E., Ponting C.P.;
RT   "Lineage-specific biology revealed by a finished genome assembly of
RT   the mouse.";
RL   PLoS Biol. 7:E1000112-E1000112(2009).
RN   [3]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 124-1818 (ISOFORM 2).
RC   STRAIN=Czech II, and FVB/N; TISSUE=Mammary tumor;
RX   PubMed=15489334; DOI=10.1101/gr.2596504;
RG   The MGC Project Team;
RT   "The status, quality, and expansion of the NIH full-length cDNA
RT   project: the Mammalian Gene Collection (MGC).";
RL   Genome Res. 14:2121-2127(2004).
CC   -!- FUNCTION: Integrin alpha-6/beta-4 is a receptor for laminin. It
CC       plays a critical structural role in the hemidesmosome of
CC       epithelial cells. Is required for the regulation of keratinocyte
CC       polarity and motility (By similarity).
CC   -!- SUBUNIT: Heterodimer of an alpha and a beta subunit. Beta-4
CC       associates with alpha-6. Interacts (via cytoplasmic region) with
CC       COL17A1 (via cytoplasmic region). Interacts (via cytoplasmic
CC       region) with DST isoform 3 (via N-terminus). Interacts (via
CC       cytoplasmic domain) with DST (via N-terminus). Interacts with RAC1
CC       (By similarity).
CC   -!- SUBCELLULAR LOCATION: Cell membrane; Single-pass type I membrane
CC       protein (By similarity). Cell membrane; Lipid-anchor (By
CC       similarity). Cell junction, hemidesmosome (By similarity).
CC       Note=Colocalizes with DST at the leading edge of migrating
CC       keratinocytes (By similarity).
CC   -!- ALTERNATIVE PRODUCTS:
CC       Event=Alternative splicing; Named isoforms=3;
CC       Name=1;
CC         IsoId=A2A863-1; Sequence=Displayed;
CC       Name=2;
CC         IsoId=A2A863-2; Sequence=VSP_037636;
CC       Name=3;
CC         IsoId=A2A863-3; Sequence=VSP_037636, VSP_037637;
CC   -!- DOMAIN: The fibronectin type-III-like domains bind BPAG1 and
CC       plectin and probably also recruit BP230 (By similarity).
CC   -!- PTM: Palmitoylated by DHHC3 at several cysteines of the membrane-
CC       proximal region, enhancing stability and cell surface expression.
CC       Palmitoylation also promotes secundary association with
CC       tertaspanins (By similarity).
CC   -!- SIMILARITY: Belongs to the integrin beta chain family.
CC   -!- SIMILARITY: Contains 1 Calx-beta domain.
CC   -!- SIMILARITY: Contains 4 fibronectin type-III domains.
CC   -!- SIMILARITY: Contains 1 PSI domain.
CC   -!- SIMILARITY: Contains 1 VWFA domain.
CC   -----------------------------------------------------------------------
CC   Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms
CC   Distributed under the Creative Commons Attribution-NoDerivs License
CC   -----------------------------------------------------------------------
DR   EMBL; AL607108; CAM24050.1; -; Genomic_DNA.
DR   EMBL; AL645647; CAM24050.1; JOINED; Genomic_DNA.
DR   EMBL; AL607108; CAM24052.1; -; Genomic_DNA.
DR   EMBL; AL645647; CAM24052.1; JOINED; Genomic_DNA.
DR   EMBL; AL607108; CAM24053.1; -; Genomic_DNA.
DR   EMBL; AL645647; CAM24053.1; JOINED; Genomic_DNA.
DR   EMBL; BC006632; AAH06632.1; -; mRNA.
DR   EMBL; BC025194; AAH25194.1; -; mRNA.
DR   EMBL; BC059192; AAH59192.1; -; mRNA.
DR   PIR; JN0786; JN0786.
DR   RefSeq; XP_006532635.1; XM_006532572.1. [A2A863-1]
DR   RefSeq; XP_006532636.1; XM_006532573.1. [A2A863-3]
DR   RefSeq; XP_006532637.1; XM_006532574.1. [A2A863-2]
DR   UniGene; Mm.213873; -.
DR   ProteinModelPortal; A2A863; -.
DR   SMR; A2A863; 29-711, 933-1111, 1128-1340, 1515-1746.
DR   PhosphoSite; A2A863; -.
DR   MaxQB; A2A863; -.
DR   PaxDb; A2A863; -.
DR   PRIDE; A2A863; -.
DR   Ensembl; ENSMUST00000068981; ENSMUSP00000070811; ENSMUSG00000020758. [A2A863-2]
DR   Ensembl; ENSMUST00000106458; ENSMUSP00000102066; ENSMUSG00000020758. [A2A863-1]
DR   Ensembl; ENSMUST00000106460; ENSMUSP00000102068; ENSMUSG00000020758. [A2A863-3]
DR   Ensembl; ENSMUST00000106461; ENSMUSP00000102069; ENSMUSG00000020758. [A2A863-1]
DR   GeneID; 192897; -.
DR   KEGG; mmu:192897; -.
DR   UCSC; uc007mji.1; mouse. [A2A863-2]
DR   CTD; 3691; -.
DR   MGI; MGI:96613; Itgb4.
DR   eggNOG; NOG303049; -.
DR   GeneTree; ENSGT00730000110513; -.
DR   HOGENOM; HOG000231105; -.
DR   InParanoid; A2A863; -.
DR   KO; K06525; -.
DR   OMA; TIIKEQA; -.
DR   OrthoDB; EOG7T7GSB; -.
DR   PhylomeDB; A2A863; -.
DR   TreeFam; TF105392; -.
DR   ChiTaRS; ITGB4; mouse.
DR   PRO; PR:A2A863; -.
DR   ArrayExpress; A2A863; -.
DR   Bgee; A2A863; -.
DR   Genevestigator; A2A863; -.
DR   GO; GO:0009925; C:basal plasma membrane; IDA:MGI.
DR   GO; GO:0005604; C:basement membrane; IDA:MGI.
DR   GO; GO:0031252; C:cell leading edge; ISS:UniProtKB.
DR   GO; GO:0030056; C:hemidesmosome; IDA:MGI.
DR   GO; GO:0008305; C:integrin complex; IDA:MGI.
DR   GO; GO:0043235; C:receptor complex; ISO:MGI.
DR   GO; GO:0004872; F:receptor activity; IEA:InterPro.
DR   GO; GO:0007155; P:cell adhesion; IMP:MGI.
DR   GO; GO:0048870; P:cell motility; ISS:UniProtKB.
DR   GO; GO:0007160; P:cell-matrix adhesion; IEA:InterPro.
DR   GO; GO:0046847; P:filopodium assembly; IMP:MGI.
DR   GO; GO:0031581; P:hemidesmosome assembly; IEA:InterPro.
DR   GO; GO:0007229; P:integrin-mediated signaling pathway; IEA:UniProtKB-KW.
DR   GO; GO:0007275; P:multicellular organismal development; IEA:InterPro.
DR   GO; GO:0009611; P:response to wounding; ISS:UniProtKB.
DR   Gene3D; 2.60.40.10; -; 4.
DR   Gene3D; 3.40.50.410; -; 1.
DR   InterPro; IPR003644; Calx_beta.
DR   InterPro; IPR013032; EGF-like_CS.
DR   InterPro; IPR003961; Fibronectin_type3.
DR   InterPro; IPR013783; Ig-like_fold.
DR   InterPro; IPR015812; Integrin_bsu.
DR   InterPro; IPR012013; Integrin_bsu-4.
DR   InterPro; IPR002369; Integrin_bsu_N.
DR   InterPro; IPR012896; Integrin_bsu_tail.
DR   InterPro; IPR016201; Plexin-like_fold.
DR   InterPro; IPR002035; VWF_A.
DR   PANTHER; PTHR10082; PTHR10082; 1.
DR   PANTHER; PTHR10082:SF6; PTHR10082:SF6; 1.
DR   Pfam; PF03160; Calx-beta; 1.
DR   Pfam; PF00041; fn3; 4.
DR   Pfam; PF07965; Integrin_B_tail; 1.
DR   Pfam; PF00362; Integrin_beta; 1.
DR   PIRSF; PIRSF002513; Integrin_B4; 1.
DR   PRINTS; PR01186; INTEGRINB.
DR   SMART; SM00237; Calx_beta; 1.
DR   SMART; SM00060; FN3; 4.
DR   SMART; SM00187; INB; 1.
DR   SMART; SM00423; PSI; 1.
DR   SMART; SM00327; VWA; 1.
DR   SUPFAM; SSF103575; SSF103575; 1.
DR   SUPFAM; SSF49265; SSF49265; 2.
DR   SUPFAM; SSF53300; SSF53300; 1.
DR   SUPFAM; SSF69687; SSF69687; 1.
DR   PROSITE; PS00022; EGF_1; 2.
DR   PROSITE; PS01186; EGF_2; 2.
DR   PROSITE; PS50853; FN3; 4.
DR   PROSITE; PS00243; INTEGRIN_BETA; 2.
PE   2: Evidence at transcript level;
KW   Alternative splicing; Cell adhesion; Cell junction; Cell membrane;
KW   Complete proteome; Disulfide bond; Glycoprotein; Integrin;
KW   Lipoprotein; Membrane; Palmitate; Phosphoprotein; Receptor;
KW   Reference proteome; Repeat; Signal; Transmembrane;
KW   Transmembrane helix.
FT   SIGNAL        1     28       By similarity.
FT   CHAIN        29   1818       Integrin beta-4.
FT                                /FTId=PRO_0000379078.
FT   TOPO_DOM     29    712       Extracellular (Potential).
FT   TRANSMEM    713    733       Helical; (Potential).
FT   TOPO_DOM    734   1818       Cytoplasmic (Potential).
FT   DOMAIN       30     74       PSI.
FT   DOMAIN      132    310       VWFA.
FT   REPEAT      458    504       I.
FT   REPEAT      505    544       II.
FT   REPEAT      545    583       III.
FT   REPEAT      584    621       IV.
FT   DOMAIN      981   1086       Calx-beta.
FT   DOMAIN     1131   1220       Fibronectin type-III 1.
FT   DOMAIN     1224   1323       Fibronectin type-III 2.
FT   DOMAIN     1526   1621       Fibronectin type-III 3.
FT   DOMAIN     1639   1735       Fibronectin type-III 4.
FT   REGION      458    621       Cysteine-rich tandem repeats.
FT   REGION      734    751       Palmitoylated on several cysteines (By
FT                                similarity).
FT   MOTIF       473    475       Cell attachment site (Potential).
FT   MOTIF      1005   1007       Cell attachment site (Potential).
FT   MOD_RES    1526   1526       Phosphothreonine (By similarity).
FT   CARBOHYD    328    328       N-linked (GlcNAc...) (Potential).
FT   CARBOHYD    493    493       N-linked (GlcNAc...) (Potential).
FT   CARBOHYD    581    581       N-linked (GlcNAc...) (Potential).
FT   CARBOHYD    619    619       N-linked (GlcNAc...) (Potential).
FT   CARBOHYD    697    697       N-linked (GlcNAc...) (Potential).
FT   DISULFID     31    457       By similarity.
FT   DISULFID     39     49       By similarity.
FT   DISULFID     42     73       By similarity.
FT   DISULFID     52     62       By similarity.
FT   DISULFID    246    289       By similarity.
FT   DISULFID    425    673       By similarity.
FT   DISULFID    454    459       By similarity.
FT   DISULFID    470    481       By similarity.
FT   DISULFID    478    514       By similarity.
FT   DISULFID    483    492       By similarity.
FT   DISULFID    494    505       By similarity.
FT   DISULFID    520    525       By similarity.
FT   DISULFID    522    553       By similarity.
FT   DISULFID    527    538       By similarity.
FT   DISULFID    559    564       By similarity.
FT   DISULFID    566    575       By similarity.
FT   DISULFID    577    584       By similarity.
FT   DISULFID    598    603       By similarity.
FT   DISULFID    600    650       By similarity.
FT   DISULFID    605    616       By similarity.
FT   DISULFID    628    637       By similarity.
FT   DISULFID    634    708       By similarity.
FT   DISULFID    653    682       By similarity.
FT   VAR_SEQ    1372   1436       Missing (in isoform 2 and isoform 3).
FT                                /FTId=VSP_037636.
FT   VAR_SEQ    1515   1515       Q -> QGLPPIWEDGRSRLPLSWTLGSLSRAHMKGVPASRG
FT                                SPDSIILAGQSAAPSWGT (in isoform 3).
FT                                /FTId=VSP_037637.
FT   CONFLICT     17     17       A -> R (in Ref. 1).
FT   CONFLICT     67     68       EL -> DV (in Ref. 1).
FT   CONFLICT     94     94       D -> V (in Ref. 1).
FT   CONFLICT    113    113       P -> R (in Ref. 1).
FT   CONFLICT    118    118       S -> T (in Ref. 1).
FT   CONFLICT    624    624       Missing (in Ref. 1).
FT   CONFLICT    666    666       Missing (in Ref. 1).
FT   CONFLICT    709    713       PPGSF -> LPAPS (in Ref. 1).
FT   CONFLICT    851    851       E -> K (in Ref. 3; AAH59192).
FT   CONFLICT    877    877       T -> A (in Ref. 1 and 3; AAH06632/
FT                                AAH59192).
FT   CONFLICT    972    972       G -> S (in Ref. 1).
FT   CONFLICT   1105   1107       Missing (in Ref. 1).
FT   CONFLICT   1204   1204       Q -> K (in Ref. 1).
FT   CONFLICT   1292   1292       E -> D (in Ref. 1).
FT   CONFLICT   1537   1537       P -> R (in Ref. 1).
FT   CONFLICT   1552   1552       M -> T (in Ref. 1 and 3; AAH06632/
FT                                AAH25194/AAH59192).
FT   CONFLICT   1564   1566       NGG -> TCV (in Ref. 1).
FT   CONFLICT   1590   1592       HSY -> YSH (in Ref. 1).
FT   CONFLICT   1653   1653       L -> P (in Ref. 1).
FT   CONFLICT   1662   1663       RP -> SR (in Ref. 1).
FT   CONFLICT   1744   1744       H -> N (in Ref. 1).
FT   CONFLICT   1759   1759       V -> M (in Ref. 3; AAH25194).
SQ   SEQUENCE   1818 AA;  201650 MW;  CA41A7E6B4E20B59 CRC64;
     MAGPCCSPWV KLLLLAAMLS ASLPGDLANR CKKAQVKSCT ECIRVDKSCA YCTDELFKER
     RCNTQAELLA AGCRGESILV MESSLEITEN TQIDTSLHRS QVSPQGLQVR LRPGEERSFV
     FQVFEPLESP VDLYILMDFS NSMSDDLDNL KQMGQNLAKI LRQLTSDYTI GFGKFVDKVS
     VPQTDMRPEK LKEPWPNSDP PFSFKNVISL TENVEEFWNK LQGERISGNL DAPEGGFDAI
     LQTAVCTRDI GWRADSTHLL VFSTESAFHY EADGANVLAG IMNRNDEKCH LDASGAYTQY
     KTQDYPSVPT LVRLLAKHNI IPIFAVTNYS YSYYEKLHKY FPVSSLGVLQ EDSSNIVELL
     EEAFYRIRSN LDIRALDSPR GLRTEVTSDT LQKTETGSFH IKRGEVGTYN VHLRAVEDID
     GTHVCQLAKE DQGGNIHLKP SFSDGLRMDA SVICDVCPCE LQKEVRSARC HFRGDFMCGH
     CVCNEGWSGK TCNCSTGSLS DTQPCLREGE DKPCSGHGEC QCGRCVCYGE GRYEGHFCEY
     DNFQCPRTSG FLCNDRGRCS MGECVCEPGW TGRSCDCPLS NATCIDSNGG ICNGRGYCEC
     GRCHCNQQSL YTDTTCEINY SAIRLGLCED LRSCVQCQAW GTGEKKGRAC DDCPFKVKMV
     DELKKAEEVV EYCSFRDEDD DCTYSYNVEG DGSPGPNSTV LVHKKKDCPP GSFWWLIPLL
     IFLLLLLALL LLLCWKYCAC CKACLGLLPC CNRGHMVGFK EDHYMLRENL MASDHLDTPM
     LRSGNLKGRD TVRWKITNNV QRPGFATHAA STSPTELVPY GLSLRLGRLC TENLMKPGTR
     ECDQLRQEVE ENLNEVYRQV SGAHKLQQTK FRQQPNTGKK QDHTIVDTVL LAPRSAKQML
     LKLTEKQVEQ GSFHELKVAP GYYTVTAEQD ARGMVEFQEG VELVDVRVPL FIRPEDDDEK
     QLLVEAIDVP VGTATLGRRL VNITIIKEQA SGVVSFEQPE YSVSRGDQVA RIPVIRHILD
     NGKSQVSYST QDNTAHGHRD YVPVEGELLF HPGETWKELQ VKLLELQEVD SLLRGRQVRR
     FQVQLSNPKF GARLGQPSTT TVILGEHDET DRSLINQTLS SPPPPHGDLG APQNPNAKAA
     GSRKIHFNWL PPPGKPMGYR VKYWIQGDSE SEAHLLDSKV PSVELTNLYP YCDYEMKVCA
     YGAQGEGPYS SLVSCRTHQE VPSEPGRLAF NVVSSTVTQL SWAEPAETNG EITAYEVCYG
     LVNEDNRPIG PMKKVLVDNP KNRMLLIENL RESQPYRYTV KARNGAGWGP EREAIINLAT
     QPKRPMSIPI IPDIPIVDAQ GGEDYENFLM YSDDVLRSPA SSQRPSVSDD TGCGWKFEPL
     LGEELDLRRV TWRLPPELIP RLSASSGRSD EDGSVAGGVE GEGSGWIRGA TPRPPGEHLV
     NGRMDFAYPG SANSLHRMTA ANVAYGTHLS PHLSHRVLST SSTLTRDYHS LTRTEHSHSG
     TLPRDYSTLT SLSSQDSRGA VGVPDTPTRL VFSALGPTSL KVSWQEPQCD RMLLGYSVEY
     QLLNGGEMHR LNIPNPGQTS VVVEDLLPNH SYVFRVRAQS QEGWGREREG VITIESQVHP
     QSPLCPLPGS AFTLSTPSAP GPLVFTALSP DSLQLSWERP RRPNGDILGY LVTCEMAQGG
     APARTFRVDG DNPESRLTVP GLSENVPYKF KVQARTTEGF GPEREGIITI ESQVGGPFPQ
     LGSHSGLFQN PVQSEFSSVT STHSTTTEPF LMDGLTLGTQ RLEAGGSLTR HVTQEFVTRT
     LTASGSLSTH MDQQFFQT
//
DBGET integrated database retrieval system