
Database: UniProt
Entry: P09095
LinkDB: P09095
Original site: P09095 
ID   TYCA_BREPA              Reviewed;        1088 AA.
AC   P09095; O30407;
DT   01-JUL-1989, integrated into UniProtKB/Swiss-Prot.
DT   15-JUL-1999, sequence version 2.
DT   05-OCT-2016, entry version 108.
DE   RecName: Full=Tyrocidine synthase 1;
DE   AltName: Full=Tyrocidine synthase I;
DE   Includes:
DE     RecName: Full=ATP-dependent D-phenylalanine adenylase;
DE              Short=D-PheA;
DE     AltName: Full=D-phenylalanine activase;
DE   Includes:
DE     RecName: Full=Phenylalanine racemase [ATP-hydrolyzing];
DE              EC=;
GN   Name=tycA;
OS   Brevibacillus parabrevis.
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Paenibacillaceae;
OC   Brevibacillus.
OX   NCBI_TaxID=54914;
RN   [1]
RC   STRAIN=ATCC 8185 / DSM 362 / JCM 20017 / NBRC 3331 / NCDO 717 / NCIMB
RC   8598 / IAM 1031;
RX   PubMed=3267240; DOI=10.1093/nar/16.24.11841;
RA   Weckermann R., Fuerbass R., Marahiel M.A.;
RT   "Complete nucleotide sequence of the tycA gene coding the tyrocidine
RT   synthetase 1 from Bacillus brevis.";
RL   Nucleic Acids Res. 16:11841-11841(1988).
RN   [2]
RC   STRAIN=ATCC 8185 / DSM 362 / JCM 20017 / NBRC 3331 / NCDO 717 / NCIMB
RC   8598 / IAM 1031;
RX   PubMed=9352938;
RA   Mootz H.D., Marahiel M.A.;
RT   "The tyrocidine biosynthesis operon of Bacillus brevis: complete
RT   nucleotide sequence and biochemical characterization of functional
RT   internal adenylation domains.";
RL   J. Bacteriol. 179:6843-6850(1997).
RN   [3]
RX   PubMed=3032912;
RA   Marahiel M.A., Zuber P., Czekay G., Losick R.;
RT   "Identification of the promoter for a peptide antibiotic biosynthesis
RT   gene from Bacillus brevis and its regulation in Bacillus subtilis.";
RL   J. Bacteriol. 169:2215-2222(1987).
RN   [4]
RP   PROTEIN SEQUENCE OF 374-385; 406-417 AND 484-496.
RX   PubMed=8193142; DOI=10.1021/bi00186a030;
RA   Pavela-Vrancic M., Pfeifer E., van Liempt H., Schafer H.J.,
RA   von Dohren H., Kleinkauf H.;
RT   "ATP binding in peptide synthetases: determination of contact sites of
RT   the adenine moiety by photoaffinity labeling of tyrocidine synthetase
RT   1 with 2-azidoadenosine triphosphate.";
RL   Biochemistry 33:6276-6283(1994).
RN   [5]
RC   STRAIN=ATCC 8185 / DSM 362 / JCM 20017 / NBRC 3331 / NCDO 717 / NCIMB
RC   8598 / IAM 1031;
RX   PubMed=2768192;
RA   Mittenhuber G., Weckermann R., Marahiel M.A.;
RT   "Gene cluster containing the genes for tyrocidine synthetases 1 and 2
RT   from Bacillus brevis: evidence for an operon.";
RL   J. Bacteriol. 171:4881-4887(1989).
CC   -!- FUNCTION: In the first step of peptide synthesis this enzyme
CC       activates phenylalanine and racemizes it to the D-isomer.
CC   -!- CATALYTIC ACTIVITY: ATP + L-phenylalanine + H(2)O = AMP +
CC       diphosphate + D-phenylalanine.
CC       Name=pantetheine 4'-phosphate; Xref=ChEBI:CHEBI:47942;
CC         Evidence={ECO:0000305};
CC       Note=Binds 1 phosphopantetheine covalently. {ECO:0000305};
CC   -!- PATHWAY: Antibiotic biosynthesis; tyrocidine biosynthesis.
CC   -!- SUBUNIT: Large multienzyme complex of TycA, TycB and TycC.
CC   -!- DOMAIN: One-module-bearing peptide synthase with a C-terminal
CC       epimerization domain. Each module incorporates one amino acid into
CC       the peptide product and can be further subdivided into domains
CC       responsible for substrate adenylation, thiolation, condensation
CC       (not for the initiation module), and epimerization (optional), and
CC       N methylation (optional).
CC   -!- MISCELLANEOUS: Tyrocidine is a mixture of four cyclic
CC       decapeptides, tyrocidine A (D-Phe-Pro-Phe-D-Phe-Asn-Gln-Tyr-Val-
CC       Orn-Leu), B, C, and D, in which Phe, at positions 3, 4, and Tyr
CC       residues are gradually replaced by Trp, depending on the relative
CC       concentrations of these amino acids in the growth medium.
CC   -!- SIMILARITY: Belongs to the ATP-dependent AMP-binding enzyme
CC       family. {ECO:0000305}.
CC   -!- SIMILARITY: Contains 1 acyl carrier domain. {ECO:0000255|PROSITE-
CC       ProRule:PRU00258}.
DR   EMBL; X13237; CAA31623.1; -; Genomic_DNA.
DR   EMBL; AF004835; AAC45928.1; -; Genomic_DNA.
DR   EMBL; M16442; AAA22876.1; ALT_FRAME; mRNA.
DR   PIR; A26878; A26878.
DR   PIR; T31074; YGBSTB.
DR   ProteinModelPortal; P09095; -.
DR   UniPathway; UPA00180; -.
DR   GO; GO:0005524; F:ATP binding; IEA:UniProtKB-KW.
DR   GO; GO:0016874; F:ligase activity; IEA:UniProtKB-KW.
DR   GO; GO:0047462; F:phenylalanine racemase (ATP-hydrolyzing) activity; IEA:UniProtKB-EC.
DR   GO; GO:0017000; P:antibiotic biosynthetic process; IEA:UniProtKB-KW.
DR   Gene3D; 1.10.1200.10; -; 1.
DR   InterPro; IPR010071; AA_adenyl_domain.
DR   InterPro; IPR025110; AMP-bd_C.
DR   InterPro; IPR020459; AMP-binding.
DR   InterPro; IPR020845; AMP-binding_CS.
DR   InterPro; IPR000873; AMP-dep_Synth/Lig.
DR   InterPro; IPR001242; Condensatn.
DR   InterPro; IPR010060; NRPS_synth.
DR   InterPro; IPR009081; PP-bd_ACP.
DR   InterPro; IPR006162; Ppantetheine_attach_site.
DR   Pfam; PF00501; AMP-binding; 1.
DR   Pfam; PF13193; AMP-binding_C; 1.
DR   Pfam; PF00668; Condensation; 1.
DR   Pfam; PF00550; PP-binding; 1.
DR   SUPFAM; SSF47336; SSF47336; 1.
DR   TIGRFAMs; TIGR01733; AA-adenyl-dom; 1.
DR   TIGRFAMs; TIGR01720; NRPS-para261; 1.
PE   1: Evidence at protein level;
KW   Antibiotic biosynthesis; ATP-binding; Direct protein sequencing;
KW   Isomerase; Ligase; Multifunctional enzyme; Nucleotide-binding;
KW   Phosphopantetheine; Phosphoprotein.
FT   CHAIN         1   1088       Tyrocidine synthase 1.
FT                                /FTId=PRO_0000193093.
FT   DOMAIN      533    599       Acyl carrier. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00258}.
FT   MOD_RES     563    563       O-(pantetheine 4'-phosphoryl)serine.
FT                                {ECO:0000255|PROSITE-ProRule:PRU00258}.
FT                                CSWLCCLAPRVHP (in Ref. 1; CAA31623).
FT                                {ECO:0000305}.
FT   CONFLICT    359    360       GS -> AD (in Ref. 1; CAA31623).
FT                                {ECO:0000305}.
FT   CONFLICT    496    496       L -> I (in Ref. 4; AA sequence).
FT                                {ECO:0000305}.
FT   CONFLICT    665    665       L -> V (in Ref. 1; CAA31623).
FT                                {ECO:0000305}.
FT   CONFLICT    737    737       L -> F (in Ref. 1; CAA31623).
FT                                {ECO:0000305}.
FT                                WQPDTRRHLQGKRSVCPKKRILFKAGHNGCKNN (in
FT                                Ref. 1; CAA31623). {ECO:0000305}.
FT                                T (in Ref. 1; CAA31623). {ECO:0000305}.
SQ   SEQUENCE   1088 AA;  122672 MW;  6AC4804199572027 CRC64;
DBGET integrated database retrieval system