GenomeNet

Database: UniProt
Entry: Q13398
LinkDB: Q13398
Original site: Q13398 
ID   ZN211_HUMAN             Reviewed;         564 AA.
AC   Q13398; B4DH10; B4DLC9; B4E3C9; B9ZVS7; B9ZVW1; F8WDV2; Q05BQ7;
AC   Q2TAL7; Q59EG4; Q59G36; Q5EBL6;
DT   30-MAY-2000, integrated into UniProtKB/Swiss-Prot.
DT   25-NOV-2008, sequence version 2.
DT   19-MAR-2014, entry version 121.
DE   RecName: Full=Zinc finger protein 211;
DE   AltName: Full=Zinc finger protein C2H2-25;
GN   Name=ZNF211;
OS   Homo sapiens (Human).
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
OC   Catarrhini; Hominidae; Homo.
OX   NCBI_TaxID=9606;
RN   [1]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 3; 5; 6 AND 7).
RC   TISSUE=Blood, Brain, Hepatoma, Tongue, and Uterus;
RX   PubMed=14702039; DOI=10.1038/ng1285;
RA   Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
RA   Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
RA   Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
RA   Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
RA   Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A.,
RA   Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M.,
RA   Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y.,
RA   Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M.,
RA   Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K.,
RA   Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S.,
RA   Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J.,
RA   Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y.,
RA   Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N.,
RA   Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
RA   Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
RA   Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
RA   Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
RA   Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
RA   Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y.,
RA   Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T.,
RA   Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y.,
RA   Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S.,
RA   Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T.,
RA   Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M.,
RA   Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T.,
RA   Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K.,
RA   Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R.,
RA   Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.;
RT   "Complete sequencing and characterization of 21,243 full-length human
RT   cDNAs.";
RL   Nat. Genet. 36:40-45(2004).
RN   [2]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4), AND VARIANT
RP   VAL-314.
RC   TISSUE=Brain, and Endothelial cell;
RA   Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S.,
RA   Ohara O., Nagase T., Kikuno R.F.;
RL   Submitted (MAR-2005) to the EMBL/GenBank/DDBJ databases.
RN   [3]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
RX   PubMed=15057824; DOI=10.1038/nature02399;
RA   Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J.,
RA   Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M.,
RA   Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E.,
RA   Caenepeel S., Carrano A.V., Caoile C., Chan Y.M., Christensen M.,
RA   Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C.,
RA   Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M.,
RA   Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T.,
RA   Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H.,
RA   Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S.,
RA   Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J.,
RA   Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M.,
RA   Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J.,
RA   Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D.,
RA   Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A.,
RA   Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I.,
RA   Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E.,
RA   Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M.,
RA   Rubin E.M., Lucas S.M.;
RT   "The DNA sequence and biology of human chromosome 19.";
RL   Nature 428:529-535(2004).
RN   [4]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3), NUCLEOTIDE
RP   SEQUENCE [LARGE SCALE MRNA] OF 1-505 (ISOFORM 1), NUCLEOTIDE SEQUENCE
RP   [LARGE SCALE MRNA] OF 24-564 (ISOFORM 1), AND VARIANT VAL-314.
RC   TISSUE=Chondrosarcoma, Skin, and Uterus;
RX   PubMed=15489334; DOI=10.1101/gr.2596504;
RG   The MGC Project Team;
RT   "The status, quality, and expansion of the NIH full-length cDNA
RT   project: the Mammalian Gene Collection (MGC).";
RL   Genome Res. 14:2121-2127(2004).
RN   [5]
RP   NUCLEOTIDE SEQUENCE [MRNA] OF 160-564 (ISOFORMS 1/2/3/4/5/6).
RC   TISSUE=Brain;
RX   PubMed=9096115; DOI=10.1007/s003359900414;
RA   Becker K.G., Canning R.D., Nagle J.W., Dehejia A.M.,
RA   Polymeropoulos M.H., Lee I.J., Gado A.M., Biddison W.E., Drew P.D.;
RT   "Molecular cloning and mapping of a novel developmentally regulated
RT   human C2H2-type zinc finger.";
RL   Mamm. Genome 8:287-289(1997).
RN   [6]
RP   PARTIAL NUCLEOTIDE SEQUENCE [MRNA].
RC   TISSUE=Hippocampus;
RX   PubMed=7633419; DOI=10.1093/hmg/4.4.685;
RA   Becker K.G., Nagle J.W., Canning R.D., Biddison W.E., Ozato K.,
RA   Drew P.D.;
RT   "Rapid isolation and characterization of 118 novel C2H2-type zinc
RT   finger cDNAs expressed in human brain.";
RL   Hum. Mol. Genet. 4:685-691(1995).
CC   -!- FUNCTION: May be involved in transcriptional regulation.
CC   -!- SUBCELLULAR LOCATION: Nucleus (Probable).
CC   -!- ALTERNATIVE PRODUCTS:
CC       Event=Alternative splicing; Named isoforms=8;
CC       Name=1;
CC         IsoId=Q13398-1; Sequence=Displayed;
CC       Name=2;
CC         IsoId=Q13398-2; Sequence=VSP_035702;
CC       Name=3;
CC         IsoId=Q13398-3; Sequence=VSP_035704;
CC       Name=4;
CC         IsoId=Q13398-4; Sequence=VSP_035705;
CC         Note=No experimental confirmation available;
CC       Name=5;
CC         IsoId=Q13398-5; Sequence=VSP_035703;
CC       Name=6;
CC         IsoId=Q13398-6; Sequence=VSP_035706;
CC       Name=7;
CC         IsoId=Q13398-7; Sequence=VSP_045643;
CC         Note=No experimental confirmation available;
CC       Name=8;
CC         IsoId=Q13398-8; Sequence=VSP_045643, VSP_046769;
CC         Note=Gene prediction based on EST data;
CC   -!- SIMILARITY: Belongs to the krueppel C2H2-type zinc-finger protein
CC       family.
CC   -!- SIMILARITY: Contains 12 C2H2-type zinc fingers.
CC   -!- SIMILARITY: Contains 1 KRAB domain.
CC   -!- SEQUENCE CAUTION:
CC       Sequence=AAA93261.1; Type=Erroneous initiation;
CC       Sequence=AAH34351.1; Type=Miscellaneous discrepancy; Note=Contaminating sequence. Potential poly-A sequence;
CC       Sequence=BAD93084.1; Type=Erroneous initiation;
CC   -----------------------------------------------------------------------
CC   Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms
CC   Distributed under the Creative Commons Attribution-NoDerivs License
CC   -----------------------------------------------------------------------
DR   EMBL; AK026941; -; NOT_ANNOTATED_CDS; mRNA.
DR   EMBL; AK294869; BAG57971.1; -; mRNA.
DR   EMBL; AK296942; BAG59491.1; -; mRNA.
DR   EMBL; AK297047; BAG59573.1; -; mRNA.
DR   EMBL; AK304666; BAG65441.1; -; mRNA.
DR   EMBL; AB209273; BAD92510.1; -; mRNA.
DR   EMBL; AB209847; BAD93084.1; ALT_INIT; mRNA.
DR   EMBL; AC003682; -; NOT_ANNOTATED_CDS; Genomic_DNA.
DR   EMBL; BC034351; AAH34351.1; ALT_SEQ; mRNA.
DR   EMBL; BC089440; AAH89440.1; -; mRNA.
DR   EMBL; BC110856; AAI10857.1; -; mRNA.
DR   EMBL; U38904; AAA93261.1; ALT_INIT; mRNA.
DR   RefSeq; NP_001252526.1; NM_001265597.1.
DR   RefSeq; NP_001252527.1; NM_001265598.1.
DR   RefSeq; NP_001252528.1; NM_001265599.1.
DR   RefSeq; NP_001252529.1; NM_001265600.1.
DR   RefSeq; NP_006376.2; NM_006385.3.
DR   RefSeq; NP_942152.1; NM_198855.2.
DR   UniGene; Hs.590977; -.
DR   ProteinModelPortal; Q13398; -.
DR   SMR; Q13398; 29-73, 119-564.
DR   BioGrid; 115775; 1.
DR   IntAct; Q13398; 1.
DR   PhosphoSite; Q13398; -.
DR   DMDM; 215273921; -.
DR   PaxDb; Q13398; -.
DR   PRIDE; Q13398; -.
DR   Ensembl; ENST00000240731; ENSP00000240731; ENSG00000121417. [Q13398-7]
DR   Ensembl; ENST00000254182; ENSP00000254182; ENSG00000121417. [Q13398-2]
DR   Ensembl; ENST00000299871; ENSP00000299871; ENSG00000121417. [Q13398-8]
DR   Ensembl; ENST00000347302; ENSP00000339562; ENSG00000121417. [Q13398-1]
DR   Ensembl; ENST00000391703; ENSP00000375584; ENSG00000121417. [Q13398-5]
DR   Ensembl; ENST00000420680; ENSP00000399193; ENSG00000121417. [Q13398-4]
DR   Ensembl; ENST00000541801; ENSP00000442601; ENSG00000121417. [Q13398-2]
DR   Ensembl; ENST00000544273; ENSP00000441386; ENSG00000121417. [Q13398-3]
DR   GeneID; 10520; -.
DR   KEGG; hsa:10520; -.
DR   UCSC; uc002qpq.2; human. [Q13398-1]
DR   UCSC; uc002qpt.2; human. [Q13398-3]
DR   UCSC; uc010yhb.1; human. [Q13398-4]
DR   UCSC; uc010yhe.2; human. [Q13398-2]
DR   CTD; 10520; -.
DR   GeneCards; GC19P058141; -.
DR   HGNC; HGNC:13003; ZNF211.
DR   HPA; HPA011340; -.
DR   HPA; HPA049967; -.
DR   MIM; 601856; gene.
DR   neXtProt; NX_Q13398; -.
DR   PharmGKB; PA37582; -.
DR   eggNOG; COG5048; -.
DR   HOVERGEN; HBG018163; -.
DR   InParanoid; Q13398; -.
DR   KO; K09228; -.
DR   OMA; NSNECEA; -.
DR   TreeFam; TF339848; -.
DR   Reactome; REACT_71; Gene Expression.
DR   GenomeRNAi; 10520; -.
DR   NextBio; 39896; -.
DR   PRO; PR:Q13398; -.
DR   ArrayExpress; Q13398; -.
DR   Bgee; Q13398; -.
DR   Genevestigator; Q13398; -.
DR   GO; GO:0005634; C:nucleus; IEA:UniProtKB-SubCell.
DR   GO; GO:0003677; F:DNA binding; IEA:UniProtKB-KW.
DR   GO; GO:0046872; F:metal ion binding; IEA:UniProtKB-KW.
DR   GO; GO:0006355; P:regulation of transcription, DNA-templated; IEA:UniProtKB-KW.
DR   GO; GO:0006351; P:transcription, DNA-templated; IEA:UniProtKB-KW.
DR   Gene3D; 3.30.160.60; -; 12.
DR   InterPro; IPR001909; Krueppel-associated_box.
DR   InterPro; IPR007087; Znf_C2H2.
DR   InterPro; IPR015880; Znf_C2H2-like.
DR   InterPro; IPR013087; Znf_C2H2/integrase_DNA-bd.
DR   Pfam; PF01352; KRAB; 1.
DR   SMART; SM00349; KRAB; 1.
DR   SMART; SM00355; ZnF_C2H2; 12.
DR   SUPFAM; SSF109640; SSF109640; 1.
DR   PROSITE; PS50805; KRAB; 1.
DR   PROSITE; PS00028; ZINC_FINGER_C2H2_1; 11.
DR   PROSITE; PS50157; ZINC_FINGER_C2H2_2; 12.
PE   2: Evidence at transcript level;
KW   Alternative splicing; Complete proteome; DNA-binding; Metal-binding;
KW   Nucleus; Polymorphism; Reference proteome; Repeat; Transcription;
KW   Transcription regulation; Zinc; Zinc-finger.
FT   CHAIN         1    564       Zinc finger protein 211.
FT                                /FTId=PRO_0000047455.
FT   DOMAIN       33    106       KRAB.
FT   ZN_FING     131    157       C2H2-type 1.
FT   ZN_FING     257    279       C2H2-type 2.
FT   ZN_FING     285    307       C2H2-type 3.
FT   ZN_FING     313    335       C2H2-type 4.
FT   ZN_FING     341    363       C2H2-type 5.
FT   ZN_FING     369    391       C2H2-type 6.
FT   ZN_FING     397    419       C2H2-type 7.
FT   ZN_FING     425    447       C2H2-type 8.
FT   ZN_FING     453    475       C2H2-type 9.
FT   ZN_FING     481    503       C2H2-type 10.
FT   ZN_FING     509    531       C2H2-type 11.
FT   ZN_FING     537    559       C2H2-type 12.
FT   VAR_SEQ       1     72       MLGFPPGRPQLPVQLRPQTRMATALRDPASGSVTFEDVAVY
FT                                FSWEEWDLLDEAQKHLYFDVMLENFALTSSL -> MLENFA
FT                                LTSSLGLISSWSHVVAQLGLGEVPSVLHRMFMTPASARWDQ
FT                                RGPGLHEWHLGKGMSS (in isoform 2).
FT                                /FTId=VSP_035702.
FT   VAR_SEQ       1     61       Missing (in isoform 5).
FT                                /FTId=VSP_035703.
FT   VAR_SEQ       1     30       MLGFPPGRPQLPVQLRPQTRMATALRDPAS -> MRTLRQR
FT                                EVEYFSKATQLVRGSTKDRGAQVPIATEVLFKLTQ (in
FT                                isoform 3).
FT                                /FTId=VSP_035704.
FT   VAR_SEQ       1     30       MLGFPPGRPQLPVQLRPQTRMATALRDPAS -> MISAYCN
FT                                LHLLGSSDSPASASQVAGTTGMRHHAQ (in isoform
FT                                4).
FT                                /FTId=VSP_035705.
FT   VAR_SEQ       1     20       Missing (in isoform 6).
FT                                /FTId=VSP_035706.
FT   VAR_SEQ      30     30       S -> SVPIATEVLFKLTQ (in isoform 7 and
FT                                isoform 8).
FT                                /FTId=VSP_045643.
FT   VAR_SEQ      73     73       G -> GLISSWSHVVAQLGLGEVPSVLHRMFMTPASARWDQ
FT                                RGPGLHEWHLGKGMSSG (in isoform 8).
FT                                /FTId=VSP_046769.
FT   VARIANT     110    110       D -> N (in dbSNP:rs34897843).
FT                                /FTId=VAR_047278.
FT   VARIANT     314    314       A -> V (in dbSNP:rs11879465).
FT                                /FTId=VAR_057402.
FT   CONFLICT    178    178       V -> A (in Ref. 1; AK026941).
FT   CONFLICT    276    276       Q -> L (in Ref. 1; BAG59491).
SQ   SEQUENCE   564 AA;  64535 MW;  9506968ED6E36EE7 CRC64;
     MLGFPPGRPQ LPVQLRPQTR MATALRDPAS GSVTFEDVAV YFSWEEWDLL DEAQKHLYFD
     VMLENFALTS SLGCWCGVEH EETPSEQRIS GERVPQFRTS KEGSSSQNAD SCEICCLVLR
     DILHLAEHQG TNCGQKLHTC GKQFYISANL QQHQRQHITE APFRSYVDTA SFTQSCIVHV
     SEKPFTCREI RKDFLANMRF LHQDATQTGE KPNNSNKCAV AFYSGKSHHN WGKCSKAFSH
     IDTLVQDQRI LTREGLFECS KCGKACTRRC NLIQHQKVHS EERPYECNEC GKFFTYYSSF
     IIHQRVHTGE RPYACPECGK SFSQIYSLNS HRKVHTGERP YECGECGKSF SQRSNLMQHR
     RVHTGERPYE CSECGKSFSQ NFSLIYHQRV HTGERPHECN ECGKSFSRSS SLIHHRRLHT
     GERPYECSKC GKSFKQSSSF SSHRKVHTGE RPYVCGECGK SFSHSSNLKN HQRVHTGERP
     VECSECSKSF SCKSNLIKHL RVHTGERPYE CSECGKSFSQ SSSLIQHRRV HTGKRPYQCS
     QCGKSFGCKS VLIQHQRVHI GEKP
//
DBGET integrated database retrieval system