GenomeNet

Database: UniProt
Entry: Q13568
LinkDB: Q13568
Original site: Q13568 
ID   IRF5_HUMAN              Reviewed;         498 AA.
AC   Q13568; A4D1J8; A8DUA8; A8DUA9; E7EQ16; E7EW54; Q1A7B4; Q64GA9;
AC   Q64GB1; Q64GB2; Q6RCM8; Q9BQF0;
DT   01-NOV-1997, integrated into UniProtKB/Swiss-Prot.
DT   16-APR-2002, sequence version 2.
DT   01-OCT-2014, entry version 131.
DE   RecName: Full=Interferon regulatory factor 5;
DE            Short=IRF-5;
GN   Name=IRF5;
OS   Homo sapiens (Human).
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
OC   Catarrhini; Hominidae; Homo.
OX   NCBI_TaxID=9606;
RN   [1]
RP   NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4), AND FUNCTION.
RX   PubMed=11303025; DOI=10.1074/jbc.M101216200;
RA   Barnes B.J., Moore P.A., Pitha P.M.;
RT   "Virus-specific activation of a novel interferon regulatory factor,
RT   IRF-5, results in the induction of distinct interferon alpha genes.";
RL   J. Biol. Chem. 276:23382-23390(2001).
RN   [2]
RP   NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4), AND FUNCTION.
RX   PubMed=15695821; DOI=10.1074/jbc.M412584200;
RA   Schoenemeyer A., Barnes B.J., Mancl M.E., Latz E., Goutagny N.,
RA   Pitha P.M., Fitzgerald K.A., Golenbock D.T.;
RT   "The interferon regulatory factor, IRF5, is a central mediator of
RT   toll-like receptor 7 signaling.";
RL   J. Biol. Chem. 280:17005-17012(2005).
RN   [3]
RP   NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 5), AND ALTERNATIVE
RP   SPLICING.
RX   PubMed=15805103; DOI=10.1074/jbc.M500543200;
RA   Mancl M.E., Hu G., Sangster-Guity N., Olshalsky S.L., Hoops K.,
RA   Fitzgerald-Bocarsly P., Pitha P.M., Pinder K., Barnes B.J.;
RT   "Two discrete promoters regulate the alternatively spliced human
RT   interferon regulatory factor-5 isoforms. Multiple isoforms with
RT   distinct cell type-specific expression, localization, regulation, and
RT   function.";
RL   J. Biol. Chem. 280:21078-21090(2005).
RN   [4]
RP   NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 4 AND 6).
RX   PubMed=16642019; DOI=10.1038/ng1782;
RA   Graham R.R., Kozyrev S.V., Baechler E.C., Reddy M.V., Plenge R.M.,
RA   Bauer J.W., Ortmann W.A., Koeuth T., Escribano M.F.,
RA   Collaborative Groups T.A., Pons-Estel B., Petri M., Daly M.,
RA   Gregersen P.K., Martin J., Altshuler D., Behrens T.W.,
RA   Alarcon-Riquelme M.E.;
RT   "A common haplotype of interferon regulatory factor 5 (IRF5) regulates
RT   splicing and expression and is associated with increased risk of
RT   systemic lupus erythematosus.";
RL   Nat. Genet. 38:550-555(2006).
RN   [5]
RP   NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
RA   Grossman A., Mittrucker H.W., Lantonio L., Mak T.W.;
RL   Submitted (APR-1996) to the EMBL/GenBank/DDBJ databases.
RN   [6]
RP   NUCLEOTIDE SEQUENCE [GENOMIC DNA].
RA   Livingston R.J., Shaffer T., McFarland I., Nguyen C.P., Stanaway I.B.,
RA   Rajkumar N., Johnson E.J., da Ponte S.H., Willa H., Ahearn M.O.,
RA   Bertucci C., Acklestad J., Carroll A., Swanson J., Gildersleeve H.I.,
RA   Nickerson D.A.;
RL   Submitted (OCT-2006) to the EMBL/GenBank/DDBJ databases.
RN   [7]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
RX   PubMed=12853948; DOI=10.1038/nature01782;
RA   Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H.,
RA   Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R.,
RA   Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E.,
RA   Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Cordes M., Du H.,
RA   Sun H., Edwards J., Bradshaw-Cordum H., Ali J., Andrews S., Isak A.,
RA   Vanbrunt A., Nguyen C., Du F., Lamar B., Courtney L., Kalicki J.,
RA   Ozersky P., Bielicki L., Scott K., Holmes A., Harkins R., Harris A.,
RA   Strong C.M., Hou S., Tomlinson C., Dauphin-Kohlberg S.,
RA   Kozlowicz-Reilly A., Leonard S., Rohlfing T., Rock S.M.,
RA   Tin-Wollam A.-M., Abbott A., Minx P., Maupin R., Strowmatt C.,
RA   Latreille P., Miller N., Johnson D., Murray J., Woessner J.P.,
RA   Wendl M.C., Yang S.-P., Schultz B.R., Wallis J.W., Spieth J.,
RA   Bieri T.A., Nelson J.O., Berkowicz N., Wohldmann P.E., Cook L.L.,
RA   Hickenbotham M.T., Eldred J., Williams D., Bedell J.A., Mardis E.R.,
RA   Clifton S.W., Chissoe S.L., Marra M.A., Raymond C., Haugen E.,
RA   Gillett W., Zhou Y., James R., Phelps K., Iadanoto S., Bubb K.,
RA   Simms E., Levy R., Clendenning J., Kaul R., Kent W.J., Furey T.S.,
RA   Baertsch R.A., Brent M.R., Keibler E., Flicek P., Bork P., Suyama M.,
RA   Bailey J.A., Portnoy M.E., Torrents D., Chinwalla A.T., Gish W.R.,
RA   Eddy S.R., McPherson J.D., Olson M.V., Eichler E.E., Green E.D.,
RA   Waterston R.H., Wilson R.K.;
RT   "The DNA sequence of human chromosome 7.";
RL   Nature 424:157-164(2003).
RN   [8]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
RX   PubMed=12690205; DOI=10.1126/science.1083423;
RA   Scherer S.W., Cheung J., MacDonald J.R., Osborne L.R., Nakabayashi K.,
RA   Herbrick J.-A., Carson A.R., Parker-Katiraee L., Skaug J., Khaja R.,
RA   Zhang J., Hudek A.K., Li M., Haddad M., Duggan G.E., Fernandez B.A.,
RA   Kanematsu E., Gentles S., Christopoulos C.C., Choufani S.,
RA   Kwasnicka D., Zheng X.H., Lai Z., Nusskern D.R., Zhang Q., Gu Z.,
RA   Lu F., Zeesman S., Nowaczyk M.J., Teshima I., Chitayat D., Shuman C.,
RA   Weksberg R., Zackai E.H., Grebe T.A., Cox S.R., Kirkpatrick S.J.,
RA   Rahman N., Friedman J.M., Heng H.H.Q., Pelicci P.G., Lo-Coco F.,
RA   Belloni E., Shaffer L.G., Pober B., Morton C.C., Gusella J.F.,
RA   Bruns G.A.P., Korf B.R., Quade B.J., Ligon A.H., Ferguson H.,
RA   Higgins A.W., Leach N.T., Herrick S.R., Lemyre E., Farra C.G.,
RA   Kim H.-G., Summers A.M., Gripp K.W., Roberts W., Szatmari P.,
RA   Winsor E.J.T., Grzeschik K.-H., Teebi A., Minassian B.A., Kere J.,
RA   Armengol L., Pujana M.A., Estivill X., Wilson M.D., Koop B.F.,
RA   Tosi S., Moore G.E., Boright A.P., Zlotorynski E., Kerem B.,
RA   Kroisel P.M., Petek E., Oscier D.G., Mould S.J., Doehner H.,
RA   Doehner K., Rommens J.M., Vincent J.B., Venter J.C., Li P.W.,
RA   Mural R.J., Adams M.D., Tsui L.-C.;
RT   "Human chromosome 7: DNA sequence and biology.";
RL   Science 300:767-772(2003).
RN   [9]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
RA   Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L.,
RA   Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R.,
RA   Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V.,
RA   Hannenhalli S., Turner R., Yooseph S., Lu F., Nusskern D.R.,
RA   Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H.,
RA   Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G.,
RA   Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W.,
RA   Venter J.C.;
RL   Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases.
RN   [10]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
RC   TISSUE=Kidney;
RX   PubMed=15489334; DOI=10.1101/gr.2596504;
RG   The MGC Project Team;
RT   "The status, quality, and expansion of the NIH full-length cDNA
RT   project: the Mammalian Gene Collection (MGC).";
RL   Genome Res. 14:2121-2127(2004).
RN   [11]
RP   NUCLEOTIDE SEQUENCE [MRNA] OF 130-253 (ISOFORMS 2 AND 3).
RA   Kozyrev S.V., Lewen S., Linga-Reddy P.M.V., Alarcon-Riquelme M.E.;
RT   "Structural indel variation in IRF5 is associated with a risk
RT   haplotype and defines the precise IRF5 isoforms expressed in SLE.";
RL   Submitted (SEP-2006) to the EMBL/GenBank/DDBJ databases.
RN   [12]
RP   SUBCELLULAR LOCATION, AND NUCLEAR LOCALIZATION SIGNAL.
RX   PubMed=12138184; DOI=10.1128/MCB.22.16.5721-5740.2002;
RA   Barnes B.J., Kellum M.J., Field A.E., Pitha P.M.;
RT   "Multiple regulatory domains of IRF-5 control activation, cellular
RT   localization, and induction of chemokines that mediate recruitment of
RT   T lymphocytes.";
RL   Mol. Cell. Biol. 22:5721-5740(2002).
RN   [13]
RP   INVOLVEMENT IN SUSCEPTIBILITY TO SLEB10.
RX   PubMed=15657875; DOI=10.1086/428480;
RA   Sigurdsson S., Nordmark G., Goering H.H.H., Lindroos K., Wiman A.-C.,
RA   Sturfelt G., Joensen A., Rantapaeae-Dahlqvist S., Moeller B., Kere J.,
RA   Koskenmies S., Widen E., Eloranta M.-L., Julkunen H.,
RA   Kristjansdottir H., Steinsson K., Alm G., Roennblom L.,
RA   Syvaenen A.-C.;
RT   "Polymorphisms in the tyrosine kinase 2 and interferon regulatory
RT   factor 5 genes are associated with systemic lupus erythematosus.";
RL   Am. J. Hum. Genet. 76:528-537(2005).
RN   [14]
RP   SUBCELLULAR LOCATION, AND NUCLEAR EXPORT SIGNAL.
RX   PubMed=15556946; DOI=10.1074/jbc.M408452200;
RA   Lin R., Yang L., Arguello M., Penafuerte C., Hiscott J.;
RT   "A CRM1-dependent nuclear export pathway is involved in the regulation
RT   of IRF-5 subcellular localization.";
RL   J. Biol. Chem. 280:3088-3095(2005).
RN   [15]
RP   INVOLVEMENT IN SUSCEPTIBILITY TO RHEUMATOID ARTHRITIS.
RX   PubMed=17599733; DOI=10.1002/art.22704;
RA   Sigurdsson S., Padyukov L., Kurreeman F.A., Liljedahl U., Wiman A.C.,
RA   Alfredsson L., Toes R., Ronnelid J., Klareskog L., Huizinga T.W.,
RA   Alm G., Syvanen A.C., Ronnblom L.;
RT   "Association of a haplotype in the promoter region of the interferon
RT   regulatory factor 5 gene with rheumatoid arthritis.";
RL   Arthritis Rheum. 56:2202-2210(2007).
RN   [16]
RP   INVOLVEMENT IN SUSCEPTIBILITY TO IBD14.
RX   PubMed=17881657; DOI=10.1093/hmg/ddm259;
RA   Dideberg V., Kristjansdottir G., Milani L., Libioulle C.,
RA   Sigurdsson S., Louis E., Wiman A.-C., Vermeire S., Rutgeerts P.,
RA   Belaiche J., Franchimont D., Van Gossum A., Bours V., Syvaenen A.-C.;
RT   "An insertion-deletion polymorphism in the interferon regulatory
RT   Factor 5 (IRF5) gene confers risk of inflammatory bowel diseases.";
RL   Hum. Mol. Genet. 16:3008-3016(2007).
RN   [17]
RP   UBIQUITINATION AT LYS-411 AND LYS-412 BY TRAF6.
RX   PubMed=18824541; DOI=10.1128/MCB.00662-08;
RA   Balkhi M.Y., Fitzgerald K.A., Pitha P.M.;
RT   "Functional regulation of MyD88-activated interferon regulatory factor
RT   5 by K63-linked polyubiquitination.";
RL   Mol. Cell. Biol. 28:7296-7308(2008).
RN   [18]
RP   PHOSPHORYLATION AT THR-10; SER-158; SER-293; SER-301; SER-435 AND
RP   SER-446, AND SUBCELLULAR LOCATION.
RX   PubMed=22412986; DOI=10.1371/journal.pone.0033098;
RA   Chang Foreman H.C., Van Scoy S., Cheng T.F., Reich N.C.;
RT   "Activation of interferon regulatory factor 5 by site specific
RT   phosphorylation.";
RL   PLoS ONE 7:E33098-E33098(2012).
RN   [19]
RP   X-RAY CRYSTALLOGRAPHY (2.0 ANGSTROMS) OF 232-477 OF MUTANT ASP-440,
RP   SUBUNIT, AND PHOSPHORYLATION AT SER-435; SER-437; SER-440 AND SER-446.
RX   PubMed=18836453; DOI=10.1038/nsmb.1496;
RA   Chen W., Lam S.S., Srinath H., Jiang Z., Correia J.J., Schiffer C.A.,
RA   Fitzgerald K.A., Lin K., Royer W.E. Jr.;
RT   "Insights into interferon regulatory factor activation from the
RT   crystal structure of dimeric IRF5.";
RL   Nat. Struct. Mol. Biol. 15:1213-1220(2008).
CC   -!- FUNCTION: Transcription factor involved in the induction of
CC       interferons IFNA and INFB and inflammatory cytokines upon virus
CC       infection. Activated by TLR7 or TLR8 signaling.
CC       {ECO:0000269|PubMed:11303025, ECO:0000269|PubMed:15695821}.
CC   -!- SUBUNIT: Homodimer, when phosphorylated.
CC       {ECO:0000269|PubMed:18836453}.
CC   -!- INTERACTION:
CC       Q7Z434:MAVS; NbExp=2; IntAct=EBI-3931258, EBI-995373;
CC       O43765:SGTA; NbExp=3; IntAct=EBI-3931258, EBI-347996;
CC   -!- SUBCELLULAR LOCATION: Cytoplasm. Nucleus. Note=Shuttles between
CC       the nucleus and the cytoplasm.
CC   -!- ALTERNATIVE PRODUCTS:
CC       Event=Alternative splicing; Named isoforms=6;
CC       Name=1;
CC         IsoId=Q13568-1; Sequence=Displayed;
CC       Name=2;
CC         IsoId=Q13568-2; Sequence=VSP_041375;
CC       Name=3;
CC         IsoId=Q13568-3; Sequence=VSP_043924;
CC       Name=4;
CC         IsoId=Q13568-4; Sequence=VSP_043925;
CC       Name=5;
CC         IsoId=Q13568-5; Sequence=VSP_044822;
CC       Name=6;
CC         IsoId=Q13568-6; Sequence=VSP_053330, VSP_053331;
CC   -!- PTM: Phosphorylation of serine and threonine residues in a C-
CC       terminal autoinhibitory region, stimulates dimerization, transport
CC       into the nucleus, assembly with the coactivator CBP/p300 and
CC       initiation of transcription. {ECO:0000269|PubMed:18836453,
CC       ECO:0000269|PubMed:22412986}.
CC   -!- PTM: 'Lys-63'-linked polyubiquitination by TRAF6 is required for
CC       activation. {ECO:0000269|PubMed:18824541}.
CC   -!- DISEASE: Inflammatory bowel disease 14 (IBD14) [MIM:612245]: A
CC       chronic, relapsing inflammation of the gastrointestinal tract with
CC       a complex etiology. It is subdivided into Crohn disease and
CC       ulcerative colitis phenotypes. Crohn disease may affect any part
CC       of the gastrointestinal tract from the mouth to the anus, but most
CC       frequently it involves the terminal ileum and colon. Bowel
CC       inflammation is transmural and discontinuous; it may contain
CC       granulomas or be associated with intestinal or perianal fistulas.
CC       In contrast, in ulcerative colitis, the inflammation is continuous
CC       and limited to rectal and colonic mucosal layers; fistulas and
CC       granulomas are not observed. Both diseases include extraintestinal
CC       inflammation of the skin, eyes, or joints.
CC       {ECO:0000269|PubMed:17881657}. Note=Disease susceptibility is
CC       associated with variations affecting the gene represented in this
CC       entry.
CC   -!- DISEASE: Systemic lupus erythematosus 10 (SLEB10) [MIM:612251]: A
CC       chronic, relapsing, inflammatory, and often febrile multisystemic
CC       disorder of connective tissue, characterized principally by
CC       involvement of the skin, joints, kidneys and serosal membranes. It
CC       is of unknown etiology, but is thought to represent a failure of
CC       the regulatory mechanisms of the autoimmune system. The disease is
CC       marked by a wide range of system dysfunctions, an elevated
CC       erythrocyte sedimentation rate, and the formation of LE cells in
CC       the blood or bone marrow. {ECO:0000269|PubMed:15657875}.
CC       Note=Disease susceptibility is associated with variations
CC       affecting the gene represented in this entry.
CC   -!- DISEASE: Rheumatoid arthritis (RA) [MIM:180300]: An inflammatory
CC       disease with autoimmune features and a complex genetic component.
CC       It primarily affects the joints and is characterized by
CC       inflammatory changes in the synovial membranes and articular
CC       structures, widespread fibrinoid degeneration of the collagen
CC       fibers in mesenchymal tissues, and by atrophy and rarefaction of
CC       bony structures. {ECO:0000269|PubMed:17599733}. Note=Disease
CC       susceptibility is associated with variations affecting the gene
CC       represented in this entry.
CC   -!- SIMILARITY: Belongs to the IRF family. {ECO:0000255|PROSITE-
CC       ProRule:PRU00840}.
CC   -!- SIMILARITY: Contains 1 IRF tryptophan pentad repeat DNA-binding
CC       domain. {ECO:0000255|PROSITE-ProRule:PRU00840}.
CC   -----------------------------------------------------------------------
CC   Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms
CC   Distributed under the Creative Commons Attribution-NoDerivs License
CC   -----------------------------------------------------------------------
DR   EMBL; AY504947; AAR90326.1; -; mRNA.
DR   EMBL; AY504946; AAR90325.1; -; mRNA.
DR   EMBL; AY693665; AAU12877.1; -; mRNA.
DR   EMBL; AY693666; AAU12878.1; -; mRNA.
DR   EMBL; AY693668; AAU12880.1; -; mRNA.
DR   EMBL; DQ277633; ABB88960.1; -; mRNA.
DR   EMBL; DQ277634; ABB88961.1; -; mRNA.
DR   EMBL; U51127; AAA96056.1; -; mRNA.
DR   EMBL; EF064718; ABK41901.1; -; Genomic_DNA.
DR   EMBL; AC025594; -; NOT_ANNOTATED_CDS; Genomic_DNA.
DR   EMBL; CH236950; EAL24107.1; -; Genomic_DNA.
DR   EMBL; CH236950; EAL24108.1; -; Genomic_DNA.
DR   EMBL; CH471070; EAW83703.1; -; Genomic_DNA.
DR   EMBL; CH471070; EAW83705.1; -; Genomic_DNA.
DR   EMBL; BC004201; AAH04201.1; -; mRNA.
DR   EMBL; BC004139; AAH04139.1; -; mRNA.
DR   EMBL; DQ995495; ABL96293.1; -; Genomic_DNA.
DR   EMBL; DQ995496; ABL96294.1; -; Genomic_DNA.
DR   CCDS; CCDS43645.1; -. [Q13568-2]
DR   CCDS; CCDS56512.1; -. [Q13568-5]
DR   CCDS; CCDS5808.1; -. [Q13568-1]
DR   PIR; G02474; G02474.
DR   RefSeq; NP_001092097.2; NM_001098627.3. [Q13568-1]
DR   RefSeq; NP_001092099.1; NM_001098629.2. [Q13568-2]
DR   RefSeq; NP_001092100.1; NM_001098630.2. [Q13568-1]
DR   RefSeq; NP_001229381.1; NM_001242452.2. [Q13568-5]
DR   RefSeq; NP_116032.1; NM_032643.4. [Q13568-1]
DR   RefSeq; XP_005250374.1; XM_005250317.1. [Q13568-2]
DR   RefSeq; XP_006716037.1; XM_006715974.1. [Q13568-2]
DR   UniGene; Hs.521181; -.
DR   PDB; 3DSH; X-ray; 2.00 A; A=232-477.
DR   PDBsum; 3DSH; -.
DR   ProteinModelPortal; Q13568; -.
DR   SMR; Q13568; 19-119, 232-467.
DR   BioGrid; 109871; 34.
DR   DIP; DIP-46348N; -.
DR   IntAct; Q13568; 11.
DR   STRING; 9606.ENSP00000349770; -.
DR   PhosphoSite; Q13568; -.
DR   DMDM; 20178305; -.
DR   MaxQB; Q13568; -.
DR   PaxDb; Q13568; -.
DR   PRIDE; Q13568; -.
DR   DNASU; 3663; -.
DR   Ensembl; ENST00000249375; ENSP00000249375; ENSG00000128604. [Q13568-1]
DR   Ensembl; ENST00000357234; ENSP00000349770; ENSG00000128604. [Q13568-2]
DR   Ensembl; ENST00000402030; ENSP00000385352; ENSG00000128604. [Q13568-1]
DR   Ensembl; ENST00000465603; ENSP00000418534; ENSG00000128604. [Q13568-6]
DR   Ensembl; ENST00000473745; ENSP00000419149; ENSG00000128604. [Q13568-1]
DR   Ensembl; ENST00000477535; ENSP00000419950; ENSG00000128604. [Q13568-5]
DR   GeneID; 3663; -.
DR   KEGG; hsa:3663; -.
DR   UCSC; uc003vog.3; human. [Q13568-2]
DR   UCSC; uc003voh.3; human. [Q13568-1]
DR   CTD; 3663; -.
DR   GeneCards; GC07P128577; -.
DR   HGNC; HGNC:6120; IRF5.
DR   HPA; HPA046700; -.
DR   MIM; 180300; phenotype.
DR   MIM; 607218; gene.
DR   MIM; 612245; phenotype.
DR   MIM; 612251; phenotype.
DR   neXtProt; NX_Q13568; -.
DR   Orphanet; 206; Crohn disease.
DR   Orphanet; 220393; Diffuse cutaneous systemic sclerosis.
DR   Orphanet; 220402; Limited cutaneous systemic sclerosis.
DR   Orphanet; 186; Primary biliary cirrhosis.
DR   Orphanet; 536; Systemic lupus erythematosus.
DR   Orphanet; 771; Ulcerative colitis.
DR   PharmGKB; PA29919; -.
DR   eggNOG; NOG45024; -.
DR   HOGENOM; HOG000037433; -.
DR   HOVERGEN; HBG105715; -.
DR   KO; K09446; -.
DR   OMA; YDGPRDM; -.
DR   PhylomeDB; Q13568; -.
DR   TreeFam; TF328512; -.
DR   Reactome; REACT_25078; Interferon gamma signaling.
DR   Reactome; REACT_25162; Interferon alpha/beta signaling.
DR   EvolutionaryTrace; Q13568; -.
DR   GeneWiki; IRF5; -.
DR   GenomeRNAi; 3663; -.
DR   NextBio; 14327; -.
DR   PRO; PR:Q13568; -.
DR   ArrayExpress; Q13568; -.
DR   Bgee; Q13568; -.
DR   CleanEx; HS_IRF5; -.
DR   Genevestigator; Q13568; -.
DR   GO; GO:0005737; C:cytoplasm; IDA:BHF-UCL.
DR   GO; GO:0005829; C:cytosol; TAS:Reactome.
DR   GO; GO:0005634; C:nucleus; IDA:BHF-UCL.
DR   GO; GO:0005515; F:protein binding; IPI:IntAct.
DR   GO; GO:0000975; F:regulatory region DNA binding; IEA:InterPro.
DR   GO; GO:0003700; F:sequence-specific DNA binding transcription factor activity; IEA:InterPro.
DR   GO; GO:0019221; P:cytokine-mediated signaling pathway; TAS:Reactome.
DR   GO; GO:0051607; P:defense response to virus; IEA:UniProtKB-KW.
DR   GO; GO:0060333; P:interferon-gamma-mediated signaling pathway; TAS:Reactome.
DR   GO; GO:0043065; P:positive regulation of apoptotic process; IMP:BHF-UCL.
DR   GO; GO:0032727; P:positive regulation of interferon-alpha production; IC:BHF-UCL.
DR   GO; GO:0032728; P:positive regulation of interferon-beta production; IC:BHF-UCL.
DR   GO; GO:0032735; P:positive regulation of interleukin-12 production; IC:BHF-UCL.
DR   GO; GO:0045944; P:positive regulation of transcription from RNA polymerase II promoter; IDA:BHF-UCL.
DR   GO; GO:0032495; P:response to muramyl dipeptide; IDA:BHF-UCL.
DR   GO; GO:0032494; P:response to peptidoglycan; IDA:BHF-UCL.
DR   GO; GO:0006351; P:transcription, DNA-templated; IEA:UniProtKB-KW.
DR   GO; GO:0060337; P:type I interferon signaling pathway; TAS:Reactome.
DR   Gene3D; 1.10.10.10; -; 1.
DR   Gene3D; 2.60.200.10; -; 1.
DR   InterPro; IPR019817; Interferon_reg_fac_CS.
DR   InterPro; IPR001346; Interferon_reg_fact_DNA-bd_dom.
DR   InterPro; IPR019471; Interferon_reg_factor-3.
DR   InterPro; IPR017855; SMAD_dom-like.
DR   InterPro; IPR008984; SMAD_FHA_domain.
DR   InterPro; IPR011991; WHTH_DNA-bd_dom.
DR   Pfam; PF00605; IRF; 1.
DR   Pfam; PF10401; IRF-3; 1.
DR   PRINTS; PR00267; INTFRNREGFCT.
DR   SMART; SM00348; IRF; 1.
DR   SUPFAM; SSF49879; SSF49879; 1.
DR   PROSITE; PS00601; IRF_1; 1.
DR   PROSITE; PS51507; IRF_2; 1.
PE   1: Evidence at protein level;
KW   3D-structure; Alternative splicing; Antiviral defense;
KW   Complete proteome; Cytoplasm; DNA-binding; Immunity; Innate immunity;
KW   Isopeptide bond; Nucleus; Phosphoprotein; Reference proteome;
KW   Systemic lupus erythematosus; Transcription; Transcription regulation;
KW   Ubl conjugation.
FT   CHAIN         1    498       Interferon regulatory factor 5.
FT                                /FTId=PRO_0000154558.
FT   DNA_BIND     14    122       IRF tryptophan pentad repeat.
FT                                {ECO:0000255|PROSITE-ProRule:PRU00840}.
FT   MOTIF        12     18       Nuclear localization signal.
FT                                {ECO:0000269|PubMed:12138184}.
FT   MOTIF       150    160       Nuclear export signal.
FT   COMPBIAS    142    149       Poly-Glu.
FT   MOD_RES      10     10       Phosphothreonine.
FT                                {ECO:0000269|PubMed:22412986}.
FT   MOD_RES     158    158       Phosphoserine; by TBK1.
FT                                {ECO:0000269|PubMed:22412986}.
FT   MOD_RES     293    293       Phosphoserine; by TBK1.
FT                                {ECO:0000269|PubMed:22412986}.
FT   MOD_RES     301    301       Phosphoserine.
FT                                {ECO:0000269|PubMed:22412986}.
FT   MOD_RES     435    435       Phosphoserine.
FT                                {ECO:0000269|PubMed:18836453,
FT                                ECO:0000269|PubMed:22412986}.
FT   MOD_RES     437    437       Phosphoserine.
FT                                {ECO:0000269|PubMed:18836453}.
FT   MOD_RES     440    440       Phosphoserine.
FT                                {ECO:0000269|PubMed:18836453}.
FT   MOD_RES     446    446       Phosphoserine.
FT                                {ECO:0000269|PubMed:18836453,
FT                                ECO:0000269|PubMed:22412986}.
FT   CROSSLNK    411    411       Glycyl lysine isopeptide (Lys-Gly)
FT                                (interchain with G-Cter in ubiquitin).
FT                                {ECO:0000269|PubMed:18824541}.
FT   CROSSLNK    412    412       Glycyl lysine isopeptide (Lys-Gly)
FT                                (interchain with G-Cter in ubiquitin).
FT                                {ECO:0000269|PubMed:18824541}.
FT   VAR_SEQ     120    147       VCSNGPAPTDSQPPEDYSFGAGEEEEEE -> TPSPLRITL
FT                                LVQERRRKKRKSCRGCCQA (in isoform 6).
FT                                {ECO:0000303|PubMed:16642019}.
FT                                /FTId=VSP_053330.
FT   VAR_SEQ     148    498       Missing (in isoform 6).
FT                                {ECO:0000303|PubMed:16642019}.
FT                                /FTId=VSP_053331.
FT   VAR_SEQ     160    160       T -> TDAVQSGPHMTPYSLLK (in isoform 2).
FT                                {ECO:0000303|PubMed:15805103,
FT                                ECO:0000303|Ref.11}.
FT                                /FTId=VSP_041375.
FT   VAR_SEQ     161    247       EDVKWPPTLQPPTLRPPTLQPPTLQPPVVLGPPAPDPSPLA
FT                                PPPGNPAGFRELLSEVLEPGPLPASLPPAGEQLLPDLLISP
FT                                HMLPL -> V (in isoform 5).
FT                                {ECO:0000303|PubMed:15805103}.
FT                                /FTId=VSP_044822.
FT   VAR_SEQ     161    175       EDVKWPPTLQPPTLR -> DAVQSGPHMTPYSLLKEDVKW
FT                                (in isoform 3). {ECO:0000303|Ref.11,
FT                                ECO:0000303|Ref.5}.
FT                                /FTId=VSP_043924.
FT   VAR_SEQ     166    175       Missing (in isoform 4).
FT                                {ECO:0000303|PubMed:11303025,
FT                                ECO:0000303|PubMed:15695821,
FT                                ECO:0000303|PubMed:16642019}.
FT                                /FTId=VSP_043925.
FT   CONFLICT    253    253       K -> KK (in Ref. 3; AAU12880).
FT                                {ECO:0000305}.
FT   HELIX       235    239
FT   TURN        242    244
FT   STRAND      250    256
FT   STRAND      262    266
FT   STRAND      272    275
FT   HELIX       283    285
FT   HELIX       286    289
FT   STRAND      294    298
FT   HELIX       308    318
FT   STRAND      325    330
FT   STRAND      333    338
FT   STRAND      340    342
FT   STRAND      344    348
FT   STRAND      367    371
FT   HELIX       372    383
FT   STRAND      395    401
FT   HELIX       409    411
FT   STRAND      413    420
FT   HELIX       421    431
FT   HELIX       450    465
SQ   SEQUENCE   498 AA;  56044 MW;  01B2ED95C28384E8 CRC64;
     MNQSIPVAPT PPRRVRLKPW LVAQVNSCQY PGLQWVNGEK KLFCIPWRHA TRHGPSQDGD
     NTIFKAWAKE TGKYTEGVDE ADPAKWKANL RCALNKSRDF RLIYDGPRDM PPQPYKIYEV
     CSNGPAPTDS QPPEDYSFGA GEEEEEEEEL QRMLPSLSLT EDVKWPPTLQ PPTLRPPTLQ
     PPTLQPPVVL GPPAPDPSPL APPPGNPAGF RELLSEVLEP GPLPASLPPA GEQLLPDLLI
     SPHMLPLTDL EIKFQYRGRP PRALTISNPH GCRLFYSQLE ATQEQVELFG PISLEQVRFP
     SPEDIPSDKQ RFYTNQLLDV LDRGLILQLQ GQDLYAIRLC QCKVFWSGPC ASAHDSCPNP
     IQREVKTKLF SLEHFLNELI LFQKGQTNTP PPFEIFFCFG EEWPDRKPRE KKLITVQVVP
     VAARLLLEMF SGELSWSADS IRLQISNPDL KDRMVEQFKE LHHIWQSQQR LQPVAQAPPG
     AGLGVGQGPW PMHPAGMQ
//
DBGET integrated database retrieval system