GenomeNet

Database: UniProt
Entry: Q5VST9
LinkDB: Q5VST9
Original site: Q5VST9 
ID   OBSCN_HUMAN             Reviewed;        7968 AA.
AC   Q5VST9; Q2A664; Q5T7G8; Q5T7G9; Q5VSU2; Q86YC7; Q8NHN0; Q8NHN1;
AC   Q8NHN2; Q8NHN3; Q8NHN4; Q8NHN5; Q8NHN6; Q8NHN7; Q8NHN8; Q8NHN9;
AC   Q96AA2; Q9HCD3; Q9HCL6;
DT   16-MAY-2006, integrated into UniProtKB/Swiss-Prot.
DT   25-NOV-2008, sequence version 3.
DT   19-MAR-2014, entry version 121.
DE   RecName: Full=Obscurin;
DE            EC=2.7.11.1;
DE   AltName: Full=Obscurin-RhoGEF;
DE   AltName: Full=Obscurin-myosin light chain kinase;
DE            Short=Obscurin-MLCK;
GN   Name=OBSCN; Synonyms=KIAA1556, KIAA1639;
OS   Homo sapiens (Human).
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
OC   Catarrhini; Hominidae; Homo.
OX   NCBI_TaxID=9606;
RN   [1]
RP   NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM 3), VARIANTS THR-51;
RP   ARG-502; ASP-1508 THR-3300; ARG-4381; ARG-4450 AND HIS-4534, FUNCTION,
RP   AND INTERACTION WITH TTN AND CALMODULIN.
RC   TISSUE=Heart;
RX   PubMed=11448995; DOI=10.1083/jcb.200102110;
RA   Young P.W., Ehler E., Gautel M.;
RT   "Obscurin, a giant sarcomeric Rho guanine nucleotide exchange factor
RT   protein involved in sarcomere assembly.";
RL   J. Cell Biol. 154:123-136(2001).
RN   [2]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
RX   PubMed=16710414; DOI=10.1038/nature04727;
RA   Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D.,
RA   Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A.,
RA   Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F.,
RA   McDonald L., Evans R., Phillips K., Atkinson A., Cooper R., Jones C.,
RA   Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P.,
RA   Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K.,
RA   Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G.,
RA   Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D.,
RA   Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G.,
RA   Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J.,
RA   Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H.,
RA   Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L.,
RA   Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J.,
RA   Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R.,
RA   Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D.,
RA   Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G.,
RA   Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M.,
RA   Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J.,
RA   Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M.,
RA   Loveland J., Lovell J., Lush M.J., Lyne R., Martin S.,
RA   Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S.,
RA   Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N.,
RA   Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V.,
RA   Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J.,
RA   Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E.,
RA   Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C.,
RA   Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z.,
RA   Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E.,
RA   Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A.,
RA   Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R.,
RA   Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V.,
RA   Beck S., Rogers J., Bentley D.R.;
RT   "The DNA sequence and biological annotation of human chromosome 1.";
RL   Nature 441:315-321(2006).
RN   [3]
RP   NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 2734-4428 (ISOFORM 5), AND
RP   NUCLEOTIDE SEQUENCE [MRNA] OF 6009-7968 (ISOFORM 1).
RC   TISSUE=Cardiac myocyte;
RX   PubMed=16625316; DOI=10.1007/s10974-005-9025-6;
RA   Fukuzawa A., Idowu S., Gautel M.;
RT   "Complete human gene structure of obscurin: implications for isoform
RT   generation by differential splicing.";
RL   J. Muscle Res. Cell Motil. 26:427-434(2005).
RN   [4]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 5386-7968 (ISOFORM 2),
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 2726-7968 (ISOFORM 4), AND
RP   VARIANT VAL-7172.
RC   TISSUE=Brain;
RX   PubMed=10997877; DOI=10.1093/dnares/7.4.271;
RA   Nagase T., Kikuno R., Nakayama M., Hirosawa M., Ohara O.;
RT   "Prediction of the coding sequences of unidentified human genes.
RT   XVIII. The complete sequences of 100 new cDNA clones from brain which
RT   code for large proteins in vitro.";
RL   DNA Res. 7:273-281(2000).
RN   [5]
RP   INTERACTION WITH TTN.
RX   PubMed=11717165;
RA   Bang M.-L., Centner T., Fornoff F., Geach A.J., Gotthardt M.,
RA   McNabb M., Witt C.C., Labeit D., Gregorio C.C., Granzier H.,
RA   Labeit S.;
RT   "The complete gene sequence of titin, expression of an unusual ~700
RT   kDa titin isoform and its interaction with obscurin identify a novel
RT   Z-line to I-band linking system.";
RL   Circ. Res. 89:1065-1072(2001).
RN   [6]
RP   ALTERNATIVE SPLICING, AND TISSUE SPECIFICITY.
RX   PubMed=11814696; DOI=10.1016/S0378-1119(01)00795-8;
RA   Russell M.W., Raeker M.O., Korytkowski K.A., Sonneman K.J.;
RT   "Identification, tissue expression and chromosomal localization of
RT   human obscurin-MLCK, a member of the titin and Dbl families of myosin
RT   light chain kinases.";
RL   Gene 282:237-246(2002).
RN   [7]
RP   SUBCELLULAR LOCATION, AND INTERACTION WITH ANK1.
RX   PubMed=12527750; DOI=10.1083/jcb.200208109;
RA   Bagnato P., Barone V., Giacomello E., Rossi D., Sorrentino V.;
RT   "Binding of an ankyrin-1 isoform to obscurin suggests a molecular link
RT   between the sarcoplasmic reticulum and myofibrils in striated
RT   muscles.";
RL   J. Cell Biol. 160:245-253(2003).
RN   [8]
RP   CHROMOSOMAL TRANSLOCATION WITH PTHB1.
RX   PubMed=12618763; DOI=10.1038/sj.onc.1206332;
RA   Vernon E.G., Malik K., Reynolds P., Powlesland R., Dallosso A.R.,
RA   Jackson S., Henthorn K., Green E.D., Brown K.W.;
RT   "The parathyroid hormone-responsive B1 gene is interrupted by a
RT   t(1;7)(q42;p15) breakpoint associated with Wilms' tumour.";
RL   Oncogene 22:1371-1380(2003).
RN   [9]
RP   FUNCTION.
RX   PubMed=16205939; DOI=10.1007/s00418-005-0069-x;
RA   Borisov A.B., Sutter S.B., Kontrogianni-Konstantopoulos A.,
RA   Bloch R.J., Westfall M.V., Russell M.W.;
RT   "Essential role of obscurin in cardiac myofibrillogenesis and
RT   hypertrophic response: evidence from small interfering RNA-mediated
RT   gene silencing.";
RL   Histochem. Cell Biol. 125:227-238(2006).
RN   [10]
RP   STRUCTURE BY NMR OF 2826-3806.
RG   RIKEN structural genomics initiative (RSGI);
RT   "Solution structure of the Ig domains of human obscurin.";
RL   Submitted (AUG-2007) to the PDB data bank.
RN   [11]
RP   STRUCTURE BY NMR OF 5601-5668.
RA   Pfuhl M., Gautel M.;
RT   "Solution structure of the SH3 domain of obscurin.";
RL   Submitted (APR-2005) to the PDB data bank.
RN   [12]
RP   VARIANTS [LARGE SCALE ANALYSIS] VAL-1136; HIS-1792; MET-1930;
RP   LYS-2090; PHE-2314; GLN-3983; HIS-4558; GLN-4810 AND THR-5071.
RX   PubMed=16959974; DOI=10.1126/science.1133427;
RA   Sjoeblom T., Jones S., Wood L.D., Parsons D.W., Lin J., Barber T.D.,
RA   Mandelker D., Leary R.J., Ptak J., Silliman N., Szabo S.,
RA   Buckhaults P., Farrell C., Meeh P., Markowitz S.D., Willis J.,
RA   Dawson D., Willson J.K.V., Gazdar A.F., Hartigan J., Wu L., Liu C.,
RA   Parmigiani G., Park B.H., Bachman K.E., Papadopoulos N.,
RA   Vogelstein B., Kinzler K.W., Velculescu V.E.;
RT   "The consensus coding sequences of human breast and colorectal
RT   cancers.";
RL   Science 314:268-274(2006).
RN   [13]
RP   VARIANTS [LARGE SCALE ANALYSIS] ARG-502; SER-804; ARG-1027; SER-1086;
RP   THR-1090; THR-1091; PRO-1101; ARG-1121; VAL-1133; VAL-1136; GLN-1156;
RP   HIS-1248; VAL-1532; MET-1566; THR-1601; VAL-3389; GLU-3426; GLY-3834;
RP   SER-4823; GLN-5598 AND GLN-6473.
RX   PubMed=17344846; DOI=10.1038/nature05610;
RA   Greenman C., Stephens P., Smith R., Dalgliesh G.L., Hunter C.,
RA   Bignell G., Davies H., Teague J., Butler A., Stevens C., Edkins S.,
RA   O'Meara S., Vastrik I., Schmidt E.E., Avis T., Barthorpe S.,
RA   Bhamra G., Buck G., Choudhury B., Clements J., Cole J., Dicks E.,
RA   Forbes S., Gray K., Halliday K., Harrison R., Hills K., Hinton J.,
RA   Jenkinson A., Jones D., Menzies A., Mironenko T., Perry J., Raine K.,
RA   Richardson D., Shepherd R., Small A., Tofts C., Varian J., Webb T.,
RA   West S., Widaa S., Yates A., Cahill D.P., Louis D.N., Goldstraw P.,
RA   Nicholson A.G., Brasseur F., Looijenga L., Weber B.L., Chiew Y.-E.,
RA   DeFazio A., Greaves M.F., Green A.R., Campbell P., Birney E.,
RA   Easton D.F., Chenevix-Trench G., Tan M.-H., Khoo S.K., Teh B.T.,
RA   Yuen S.T., Leung S.Y., Wooster R., Futreal P.A., Stratton M.R.;
RT   "Patterns of somatic mutation in human cancer genomes.";
RL   Nature 446:153-158(2007).
CC   -!- FUNCTION: Involved in myofibrillogenesis. Seems to be involved in
CC       assembly of myosin into sarcomeric A bands in striated muscle.
CC       Isoform 3 together with ANK1 isoform Mu17/Ank1.5 may provide a
CC       molecular link between the sarcoplasmic reticulum and myofibrils.
CC   -!- CATALYTIC ACTIVITY: ATP + a protein = ADP + a phosphoprotein.
CC   -!- COFACTOR: Magnesium (By similarity).
CC   -!- SUBUNIT: Isoform 3 interacts with TTN/titin, ANK1 isoform
CC       Mu17/ank1.5, and with calmodulin in a Ca(2+)-independent manner.
CC       Associates with fast skeletal muscle myosin (By similarity).
CC   -!- INTERACTION:
CC       P16157:ANK1; NbExp=3; IntAct=EBI-941921, EBI-941686;
CC       P16157-17:ANK1; NbExp=8; IntAct=EBI-941921, EBI-941819;
CC       Q8WZ42:TTN; NbExp=11; IntAct=EBI-941850, EBI-681210;
CC   -!- SUBCELLULAR LOCATION: Isoform 3: Cytoplasm, myofibril, sarcomere,
CC       M line. Cytoplasm, myofibril, sarcomere, Z line. Note=In
CC       differentiating skeletal muscle cells, isoform 3 primarily
CC       localizes to the sarcomeric M-line and less frequently to the Z-
CC       disk. Isoform 3 colocalizes with ANK1 isoform Mu17/ank1.5 at the
CC       M-line in differentiated skeletal muscle cells.
CC   -!- ALTERNATIVE PRODUCTS:
CC       Event=Alternative splicing; Named isoforms=5;
CC         Comment=Additional isoforms seem to exist;
CC       Name=1; Synonyms=B, obscurin-MLCK giant kinase;
CC         IsoId=Q5VST9-1; Sequence=Displayed;
CC       Name=2;
CC         IsoId=Q5VST9-2; Sequence=VSP_018436;
CC       Name=3; Synonyms=unc-89-like;
CC         IsoId=Q5VST9-3; Sequence=VSP_018437, VSP_018438;
CC         Note=Lacks the kinase domain. Initially described as obscurin;
CC       Name=4;
CC         IsoId=Q5VST9-5; Sequence=VSP_020086, VSP_020087;
CC         Note=No experimental confirmation available. Ref.4 (BAB13382)
CC         sequence differs from that shown due to frameshifts in positions
CC         3891, 5061, 5093, 5268, 6352 and 6919;
CC       Name=5;
CC         IsoId=Q5VST9-6; Sequence=VSP_026970;
CC   -!- DISEASE: Note=A chromosomal aberration involving OBSCN has been
CC       found in Wilms tumor. Translocation t(1;7)(q42;p15) with PTHB1.
CC   -!- SIMILARITY: Belongs to the protein kinase superfamily. CAMK
CC       Ser/Thr protein kinase family.
CC   -!- SIMILARITY: Contains 1 DH (DBL-homology) domain.
CC   -!- SIMILARITY: Contains 4 fibronectin type-III domains.
CC   -!- SIMILARITY: Contains 55 Ig-like (immunoglobulin-like) domains.
CC   -!- SIMILARITY: Contains 1 IQ domain.
CC   -!- SIMILARITY: Contains 1 PH domain.
CC   -!- SIMILARITY: Contains 2 protein kinase domains.
CC   -!- SIMILARITY: Contains 1 SH3 domain.
CC   -!- CAUTION: Initially the name obscurin was used to describe isoform
CC       3 which lacks the kinase domains.
CC   -!- SEQUENCE CAUTION:
CC       Sequence=CAC85746.1; Type=Erroneous gene model prediction;
CC       Sequence=CAC85749.1; Type=Erroneous gene model prediction;
CC       Sequence=CAC85750.1; Type=Erroneous gene model prediction;
CC       Sequence=CAH71670.2; Type=Erroneous gene model prediction;
CC       Sequence=CAI19283.1; Type=Erroneous gene model prediction;
CC       Sequence=CAI19284.1; Type=Erroneous gene model prediction;
CC   -----------------------------------------------------------------------
CC   Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms
CC   Distributed under the Creative Commons Attribution-NoDerivs License
CC   -----------------------------------------------------------------------
DR   EMBL; AJ002535; CAC44768.1; -; mRNA.
DR   EMBL; AJ314896; CAC85745.1; -; Genomic_DNA.
DR   EMBL; AJ314898; CAC85746.1; ALT_SEQ; Genomic_DNA.
DR   EMBL; AJ314900; CAC85747.1; -; Genomic_DNA.
DR   EMBL; AJ314901; CAC85749.1; ALT_SEQ; Genomic_DNA.
DR   EMBL; AJ314903; CAC85750.1; ALT_SEQ; Genomic_DNA.
DR   EMBL; AJ314904; CAC85751.1; -; Genomic_DNA.
DR   EMBL; AJ314905; CAC85752.1; -; Genomic_DNA.
DR   EMBL; AJ314906; CAC85753.1; -; Genomic_DNA.
DR   EMBL; AJ314907; CAC85754.1; -; Genomic_DNA.
DR   EMBL; AJ314908; CAC85755.1; -; Genomic_DNA.
DR   EMBL; AL670729; CAH71673.1; -; Genomic_DNA.
DR   EMBL; AL353593; CAH71673.1; JOINED; Genomic_DNA.
DR   EMBL; AL359510; CAH71673.1; JOINED; Genomic_DNA.
DR   EMBL; AL359510; CAI15072.1; -; Genomic_DNA.
DR   EMBL; AL670729; CAI15072.1; JOINED; Genomic_DNA.
DR   EMBL; AL353593; CAI15072.1; JOINED; Genomic_DNA.
DR   EMBL; AL353593; CAI19283.1; ALT_SEQ; Genomic_DNA.
DR   EMBL; AL353593; CAI19284.1; ALT_SEQ; Genomic_DNA.
DR   EMBL; AL353593; CAI19285.1; -; Genomic_DNA.
DR   EMBL; AL670729; CAI19285.1; JOINED; Genomic_DNA.
DR   EMBL; AL359510; CAI19285.1; JOINED; Genomic_DNA.
DR   EMBL; AL670729; CAH71670.2; ALT_SEQ; Genomic_DNA.
DR   EMBL; AM231061; CAJ76912.1; -; mRNA.
DR   EMBL; AB046776; BAB13382.1; ALT_FRAME; mRNA.
DR   EMBL; AB046859; BAB13465.2; -; mRNA.
DR   RefSeq; NP_001092093.2; NM_001098623.2.
DR   RefSeq; NP_443075.3; NM_052843.3.
DR   UniGene; Hs.650039; -.
DR   UniGene; Hs.656999; -.
DR   PDB; 1V1C; NMR; -; A=5601-5668.
DR   PDB; 2CR6; NMR; -; A=2999-3100.
DR   PDB; 2DKU; NMR; -; A=2915-3004.
DR   PDB; 2DM7; NMR; -; A=3801-3887.
DR   PDB; 2E7B; NMR; -; A=3184-3273.
DR   PDB; 2EDF; NMR; -; A=2826-2915.
DR   PDB; 2EDH; NMR; -; A=3614-3714.
DR   PDB; 2EDL; NMR; -; A=3801-3887.
DR   PDB; 2EDQ; NMR; -; A=3713-3806.
DR   PDB; 2EDR; NMR; -; A=3361-3449.
DR   PDB; 2EDT; NMR; -; A=3449-3537.
DR   PDB; 2EDW; NMR; -; A=3537-3630.
DR   PDB; 2ENY; NMR; -; A=2735-2825.
DR   PDB; 2EO1; NMR; -; A=1623-1712.
DR   PDB; 2GQH; NMR; -; A=3718-3807.
DR   PDB; 2YZ8; X-ray; 2.00 A; A=3184-3273.
DR   PDBsum; 1V1C; -.
DR   PDBsum; 2CR6; -.
DR   PDBsum; 2DKU; -.
DR   PDBsum; 2DM7; -.
DR   PDBsum; 2E7B; -.
DR   PDBsum; 2EDF; -.
DR   PDBsum; 2EDH; -.
DR   PDBsum; 2EDL; -.
DR   PDBsum; 2EDQ; -.
DR   PDBsum; 2EDR; -.
DR   PDBsum; 2EDT; -.
DR   PDBsum; 2EDW; -.
DR   PDBsum; 2ENY; -.
DR   PDBsum; 2EO1; -.
DR   PDBsum; 2GQH; -.
DR   PDBsum; 2YZ8; -.
DR   ProteinModelPortal; Q5VST9; -.
DR   SMR; Q5VST9; 884-975, 979-1067, 1071-1159, 1163-1251, 1255-1436, 1439-1528, 1531-1620, 1623-1712, 2735-3100, 3184-3273, 3275-3898, 5601-5668.
DR   BioGrid; 123847; 6.
DR   DIP; DIP-35727N; -.
DR   IntAct; Q5VST9; 8.
DR   MINT; MINT-254901; -.
DR   PhosphoSite; Q5VST9; -.
DR   DMDM; 215274225; -.
DR   PaxDb; Q5VST9; -.
DR   PRIDE; Q5VST9; -.
DR   Ensembl; ENST00000284548; ENSP00000284548; ENSG00000154358. [Q5VST9-3]
DR   Ensembl; ENST00000422127; ENSP00000409493; ENSG00000154358. [Q5VST9-1]
DR   GeneID; 84033; -.
DR   KEGG; hsa:84033; -.
DR   UCSC; uc001hsn.4; human. [Q5VST9-3]
DR   UCSC; uc009xez.2; human. [Q5VST9-1]
DR   CTD; 84033; -.
DR   GeneCards; GC01P228395; -.
DR   H-InvDB; HIX0001664; -.
DR   H-InvDB; HIX0159663; -.
DR   H-InvDB; HIX0159975; -.
DR   H-InvDB; HIX0160154; -.
DR   HGNC; HGNC:15719; OBSCN.
DR   HPA; HPA019497; -.
DR   HPA; HPA021186; -.
DR   MIM; 608616; gene.
DR   neXtProt; NX_Q5VST9; -.
DR   PharmGKB; PA31888; -.
DR   eggNOG; COG0515; -.
DR   HOVERGEN; HBG108206; -.
DR   InParanoid; Q5VST9; -.
DR   KO; K17531; -.
DR   OrthoDB; EOG7HHWR6; -.
DR   Reactome; REACT_111102; Signal Transduction.
DR   SignaLink; Q5VST9; -.
DR   EvolutionaryTrace; Q5VST9; -.
DR   GeneWiki; OBSCN; -.
DR   GeneWiki; Obscurin; -.
DR   GenomeRNAi; 84033; -.
DR   NextBio; 73174; -.
DR   PRO; PR:Q5VST9; -.
DR   ArrayExpress; Q5VST9; -.
DR   Bgee; Q5VST9; -.
DR   Genevestigator; Q5VST9; -.
DR   GO; GO:0005829; C:cytosol; TAS:Reactome.
DR   GO; GO:0031430; C:M band; ISS:BHF-UCL.
DR   GO; GO:0030018; C:Z disc; ISS:BHF-UCL.
DR   GO; GO:0005524; F:ATP binding; IEA:UniProtKB-KW.
DR   GO; GO:0046872; F:metal ion binding; IEA:UniProtKB-KW.
DR   GO; GO:0004674; F:protein serine/threonine kinase activity; IEA:UniProtKB-KW.
DR   GO; GO:0004713; F:protein tyrosine kinase activity; IEA:InterPro.
DR   GO; GO:0005089; F:Rho guanyl-nucleotide exchange factor activity; IEA:InterPro.
DR   GO; GO:0008307; F:structural constituent of muscle; NAS:BHF-UCL.
DR   GO; GO:0097190; P:apoptotic signaling pathway; TAS:Reactome.
DR   GO; GO:0007275; P:multicellular organismal development; IEA:UniProtKB-KW.
DR   GO; GO:0048011; P:neurotrophin TRK receptor signaling pathway; TAS:Reactome.
DR   GO; GO:0018108; P:peptidyl-tyrosine phosphorylation; IEA:GOC.
DR   GO; GO:0043065; P:positive regulation of apoptotic process; TAS:Reactome.
DR   GO; GO:0036309; P:protein localization to M-band; ISS:BHF-UCL.
DR   GO; GO:0032319; P:regulation of Rho GTPase activity; IEA:GOC.
DR   GO; GO:0045214; P:sarcomere organization; TAS:BHF-UCL.
DR   GO; GO:0007264; P:small GTPase mediated signal transduction; TAS:Reactome.
DR   Gene3D; 1.20.900.10; -; 1.
DR   Gene3D; 2.30.29.30; -; 1.
DR   Gene3D; 2.60.40.10; -; 60.
DR   InterPro; IPR000219; DH-domain.
DR   InterPro; IPR003961; Fibronectin_type3.
DR   InterPro; IPR007110; Ig-like_dom.
DR   InterPro; IPR013783; Ig-like_fold.
DR   InterPro; IPR013098; Ig_I-set.
DR   InterPro; IPR003599; Ig_sub.
DR   InterPro; IPR003598; Ig_sub2.
DR   InterPro; IPR000048; IQ_motif_EF-hand-BS.
DR   InterPro; IPR011009; Kinase-like_dom.
DR   InterPro; IPR020682; Obscurin-myosin_light-ch_kin.
DR   InterPro; IPR011993; PH_like_dom.
DR   InterPro; IPR001849; Pleckstrin_homology.
DR   InterPro; IPR000719; Prot_kinase_dom.
DR   InterPro; IPR017441; Protein_kinase_ATP_BS.
DR   InterPro; IPR002290; Ser/Thr_dual-sp_kinase_dom.
DR   InterPro; IPR008271; Ser/Thr_kinase_AS.
DR   InterPro; IPR001452; SH3_domain.
DR   InterPro; IPR008266; Tyr_kinase_AS.
DR   PANTHER; PTHR19897:SF17; PTHR19897:SF17; 1.
DR   Pfam; PF00041; fn3; 2.
DR   Pfam; PF07679; I-set; 51.
DR   Pfam; PF00612; IQ; 1.
DR   Pfam; PF00069; Pkinase; 2.
DR   Pfam; PF00621; RhoGEF; 1.
DR   SMART; SM00060; FN3; 3.
DR   SMART; SM00409; IG; 33.
DR   SMART; SM00408; IGc2; 20.
DR   SMART; SM00015; IQ; 1.
DR   SMART; SM00233; PH; 1.
DR   SMART; SM00220; S_TKc; 2.
DR   SMART; SM00326; SH3; 1.
DR   SUPFAM; SSF48065; SSF48065; 1.
DR   SUPFAM; SSF49265; SSF49265; 3.
DR   SUPFAM; SSF50044; SSF50044; 1.
DR   SUPFAM; SSF56112; SSF56112; 2.
DR   PROSITE; PS50010; DH_2; 1.
DR   PROSITE; PS50853; FN3; 3.
DR   PROSITE; PS50835; IG_LIKE; 47.
DR   PROSITE; PS50096; IQ; 1.
DR   PROSITE; PS50003; PH_DOMAIN; 1.
DR   PROSITE; PS00107; PROTEIN_KINASE_ATP; 1.
DR   PROSITE; PS50011; PROTEIN_KINASE_DOM; 2.
DR   PROSITE; PS00108; PROTEIN_KINASE_ST; 1.
DR   PROSITE; PS00109; PROTEIN_KINASE_TYR; 1.
PE   1: Evidence at protein level;
KW   3D-structure; Alternative splicing; ATP-binding; Calmodulin-binding;
KW   Chromosomal rearrangement; Complete proteome; Cytoplasm;
KW   Developmental protein; Differentiation; Disulfide bond;
KW   Immunoglobulin domain; Kinase; Magnesium; Metal-binding;
KW   Muscle protein; Nucleotide-binding; Polymorphism; Reference proteome;
KW   Repeat; Serine/threonine-protein kinase; SH3 domain; Transferase.
FT   CHAIN         1   7968       Obscurin.
FT                                /FTId=PRO_0000235298.
FT   DOMAIN       10    100       Ig-like 1.
FT   DOMAIN      110    202       Ig-like 2.
FT   DOMAIN      236    322       Ig-like 3.
FT   DOMAIN      331    414       Ig-like 4.
FT   DOMAIN      420    508       Ig-like 5.
FT   DOMAIN      515    612       Fibronectin type-III 1.
FT   DOMAIN      619    698       Ig-like 6.
FT   DOMAIN      701    790       Ig-like 7.
FT   DOMAIN      798    884       Ig-like 8.
FT   DOMAIN      886    977       Ig-like 9.
FT   DOMAIN      978   1066       Ig-like 10.
FT   DOMAIN     1070   1161       Ig-like 11.
FT   DOMAIN     1162   1252       Ig-like 12.
FT   DOMAIN     1254   1345       Ig-like 13.
FT   DOMAIN     1346   1432       Ig-like 14.
FT   DOMAIN     1438   1524       Ig-like 15.
FT   DOMAIN     1530   1621       Ig-like 16.
FT   DOMAIN     1622   1719       Ig-like 17.
FT   DOMAIN     1731   1808       Fibronectin type-III 2.
FT   DOMAIN     1809   1894       Ig-like 18.
FT   DOMAIN     1896   1982       Ig-like 19.
FT   DOMAIN     1987   2071       Ig-like 20.
FT   DOMAIN     2077   2162       Ig-like 21.
FT   DOMAIN     2165   2249       Ig-like 22.
FT   DOMAIN     2289   2380       Ig-like 23.
FT   DOMAIN     2468   2559       Ig-like 24.
FT   DOMAIN     2564   2643       Ig-like 25.
FT   DOMAIN     2646   2730       Ig-like 26.
FT   DOMAIN     2736   2823       Ig-like 27.
FT   DOMAIN     2826   2908       Ig-like 28.
FT   DOMAIN     2920   2999       Ig-like 29.
FT   DOMAIN     3003   3092       Ig-like 30.
FT   DOMAIN     3095   3183       Ig-like 31.
FT   DOMAIN     3184   3268       Ig-like 32.
FT   DOMAIN     3273   3356       Ig-like 33.
FT   DOMAIN     3359   3444       Ig-like 34.
FT   DOMAIN     3449   3532       Ig-like 35.
FT   DOMAIN     3537   3620       Ig-like 36.
FT   DOMAIN     3625   3708       Ig-like 37.
FT   DOMAIN     3713   3796       Ig-like 38.
FT   DOMAIN     3801   3884       Ig-like 39.
FT   DOMAIN     3890   3973       Ig-like 40.
FT   DOMAIN     3978   4062       Ig-like 41.
FT   DOMAIN     4068   4160       Ig-like 42.
FT   DOMAIN     4171   4239       Ig-like 43.
FT   DOMAIN     4248   4337       Ig-like 44.
FT   DOMAIN     4340   4427       Ig-like 45.
FT   DOMAIN     4430   4518       Ig-like 46.
FT   DOMAIN     4525   4619       Fibronectin type-III 3.
FT   DOMAIN     4624   4714       Ig-like 47.
FT   DOMAIN     4872   4901       IQ.
FT   DOMAIN     4898   4989       Ig-like 48.
FT   DOMAIN     5126   5215       Ig-like 49.
FT   DOMAIN     5260   5349       Ig-like 50.
FT   DOMAIN     5371   5467       Ig-like 51.
FT   DOMAIN     5601   5668       SH3.
FT   DOMAIN     5693   5877       DH.
FT   DOMAIN     5895   6004       PH.
FT   DOMAIN     6014   6097       Ig-like 52.
FT   DOMAIN     6108   6200       Ig-like 53.
FT   DOMAIN     6357   6445       Ig-like 54.
FT   DOMAIN     6468   6721       Protein kinase 1.
FT   DOMAIN     7463   7552       Ig-like 55.
FT   DOMAIN     7557   7649       Fibronectin type-III 4.
FT   DOMAIN     7672   7924       Protein kinase 2.
FT   NP_BIND    6474   6482       ATP (By similarity).
FT   NP_BIND    7678   7686       ATP (By similarity).
FT   COMPBIAS    192    198       Poly-Ala.
FT   COMPBIAS    710    713       Poly-Ala.
FT   COMPBIAS    931    934       Poly-Ser.
FT   COMPBIAS   1115   1118       Poly-Ser.
FT   COMPBIAS   1207   1210       Poly-Ser.
FT   COMPBIAS   1299   1302       Poly-Ser.
FT   COMPBIAS   1391   1394       Poly-Ser.
FT   COMPBIAS   1575   1578       Poly-Ser.
FT   COMPBIAS   1667   1670       Poly-Ser.
FT   COMPBIAS   4398   4401       Poly-Leu.
FT   COMPBIAS   4846   4849       Poly-Gln.
FT   COMPBIAS   6789   6796       Poly-Ser.
FT   COMPBIAS   6969   7117       Pro-rich.
FT   ACT_SITE   6587   6587       Proton acceptor (By similarity).
FT   ACT_SITE   7791   7791       Proton acceptor (By similarity).
FT   BINDING    6497   6497       ATP (By similarity).
FT   BINDING    7701   7701       ATP (By similarity).
FT   DISULFID     31     82       By similarity.
FT   DISULFID    259    311       By similarity.
FT   DISULFID    354    404       By similarity.
FT   DISULFID    819    870       By similarity.
FT   DISULFID    912    962       By similarity.
FT   DISULFID   1004   1054       By similarity.
FT   DISULFID   1096   1146       By similarity.
FT   DISULFID   1188   1238       By similarity.
FT   DISULFID   1280   1330       By similarity.
FT   DISULFID   1372   1422       By similarity.
FT   DISULFID   1464   1514       By similarity.
FT   DISULFID   1556   1606       By similarity.
FT   DISULFID   1648   1698       By similarity.
FT   DISULFID   1723   1791       By similarity.
FT   DISULFID   1830   1880       By similarity.
FT   DISULFID   2187   2237       By similarity.
FT   DISULFID   2311   2361       By similarity.
FT   DISULFID   2490   2540       By similarity.
FT   DISULFID   2668   2718       By similarity.
FT   DISULFID   2848   2898       By similarity.
FT   DISULFID   2937   2987       By similarity.
FT   DISULFID   3117   3167       By similarity.
FT   DISULFID   3206   3256       By similarity.
FT   DISULFID   3295   3344       By similarity.
FT   DISULFID   3383   3432       By similarity.
FT   DISULFID   3471   3520       By similarity.
FT   DISULFID   3559   3608       By similarity.
FT   DISULFID   3647   3696       By similarity.
FT   DISULFID   3735   3784       By similarity.
FT   DISULFID   3823   3872       By similarity.
FT   DISULFID   3911   3961       By similarity.
FT   DISULFID   4000   4050       By similarity.
FT   DISULFID   4089   4141       By similarity.
FT   DISULFID   4453   4508       By similarity.
FT   DISULFID   4919   4971       By similarity.
FT   DISULFID   5147   5199       By similarity.
FT   DISULFID   6035   6087       By similarity.
FT   DISULFID   6129   6182       By similarity.
FT   DISULFID   7484   7536       By similarity.
FT   VAR_SEQ    3886   3886       R -> RALPARFTQDLKTKEASEGATATLQCELSKVAPVEW
FT                                KKGPETLRDGGRYSLKQDGTRCELQIHDLSVADAGEYSCMC
FT                                GQERTSATLTVRALPARFTEGLRNEEAMEGATATLQCELSK
FT                                AAPVEWRKGLEALRDGDKYSLRQDGAVCELQIHGLAMADNG
FT                                VYSCVCGQERTSATLTVRALPARFIEDMRNQKATEGATVTL
FT                                QCKLRKAAPVEWRKGPNTLKDGDRYSLKQDGTSCELQIRGL
FT                                VIADAGEYSCICEQERTSATLTVRALPARFIEDVRNHEATE
FT                                GATAVLQCELSKAAPVEWRKGSETLRDGDRYSLRQDGTRCE
FT                                LQIRGLAVEDTGEYLCVCGQERTSATLTVRALPARFIDNMT
FT                                NQEAREGATATLHCELSKVAPVEWRKGPETLRDGDRHSLRQ
FT                                DGTRCELQIRGLSVADAGEYSCVCGQERTSATLTIREATEG
FT                                ATAMLQCELSKVAPVEWRKGPETLRDGDRYNLRQDGTRCEL
FT                                QIHGLSVADTGEYSCVCGQEKTSATLTVK (in isoform
FT                                5).
FT                                /FTId=VSP_026970.
FT   VAR_SEQ    3888   3913       PQPVFREPLQSLQAEEGSTATLQCEL -> LPARIHSRSED
FT                                QGGLRRGHSYTAV (in isoform 4).
FT                                /FTId=VSP_020086.
FT   VAR_SEQ    3914   7968       Missing (in isoform 4).
FT                                /FTId=VSP_020087.
FT   VAR_SEQ    5753   5753       S -> SS (in isoform 2).
FT                                /FTId=VSP_018436.
FT   VAR_SEQ    6221   6620       DTTLERADQEVTSVLKRLLGPKAPGPSTGDLTGPGPCPRGA
FT                                PALQETGSQPPVTGTSEAPAVPPRVPQPLLHEGPEQEPEAI
FT                                ARAQEWTVPIRMEGAAWPGAGTGELLWDVHSHVVRETTQRT
FT                                YTYQAIDTHTARPPSMQVTIEDVQAQTGGTAQFEAIIEGDP
FT                                QPSVTWYKDSVQLVDSTRLSQQQEGTTYSLVLRHVASKDAG
FT                                VYTCLAQNTGGQVLCKAELLVLGGDNEPDSEKQSHRRKLHS
FT                                FYEVKEEIGRGVFGFVKRVQHKGNKILCAAKFIPLRSRTRA
FT                                QAYRERDILAALSHPLVTGLLDQFETRKTLILILELCSSEE
FT                                LLDRLYRKGVVTEAEVKVYIQQLVEGLHYLHSHGVLHLDIK
FT                                PSNILMVHPAREDIKICDFGFAQNITPAELQ -> VTEQET
FT                                KVPKKTVIIEETITTVVKSPRGQRRSPSKSPSRSPSRCSAS
FT                                PLRPGLLAPDLLYLPGAGQPRRPEAEPGQKPVVPTLYVTEA
FT                                EAHSPALPGLSGPQPKWVEVEETIEVRVKKMGPQGVSPTTE
FT                                VPRSSSGHLFTLPGATPGGDPNSNNSNNKLLAQEAWAQGTA
FT                                MVGVREPLVFRVDARGSVDWAASGMGSLEEEGTMEEAGEEE
FT                                GEDGDAFVTEESQDTHSLGDRDPKILTHNGRMLTLADLEDY
FT                                VPGEGETFHCGGPGPGAPDDPPCEVSVIQREIGEPTVGQPV
FT                                LLSVGHALGPRGPLGLFRPEPRGASPPGPQVRSLEGTSFLL
FT                                REAPARPVGSAPWTQSFCTRIRRSADSGQSSFTTELSTQTV
FT                                NFGTVGETVTLHICPDRDGDEAAQP (in isoform 3).
FT                                /FTId=VSP_018437.
FT   VAR_SEQ    6621   7968       Missing (in isoform 3).
FT                                /FTId=VSP_018438.
FT   VARIANT      51     51       A -> T (in dbSNP:rs1771487).
FT                                /FTId=VAR_026409.
FT   VARIANT     502    502       Q -> R (in dbSNP:rs1771487).
FT                                /FTId=VAR_034618.
FT   VARIANT     804    804       G -> S (in dbSNP:rs55950009).
FT                                /FTId=VAR_042276.
FT   VARIANT     908    908       A -> T (in dbSNP:rs1757153).
FT                                /FTId=VAR_047743.
FT   VARIANT    1027   1027       K -> R (in dbSNP:rs55760713).
FT                                /FTId=VAR_042277.
FT   VARIANT    1086   1086       A -> S.
FT                                /FTId=VAR_042278.
FT   VARIANT    1090   1090       A -> T.
FT                                /FTId=VAR_042279.
FT   VARIANT    1091   1091       S -> T.
FT                                /FTId=VAR_042280.
FT   VARIANT    1101   1101       A -> P.
FT                                /FTId=VAR_042281.
FT   VARIANT    1121   1121       G -> R.
FT                                /FTId=VAR_042282.
FT   VARIANT    1133   1133       L -> V.
FT                                /FTId=VAR_042283.
FT   VARIANT    1136   1136       A -> V (in a colorectal cancer sample;
FT                                somatic mutation).
FT                                /FTId=VAR_035530.
FT   VARIANT    1156   1156       H -> Q.
FT                                /FTId=VAR_042284.
FT   VARIANT    1248   1248       Q -> H.
FT                                /FTId=VAR_042285.
FT   VARIANT    1508   1508       V -> D (in dbSNP:rs7532342).
FT                                /FTId=VAR_034619.
FT   VARIANT    1532   1532       A -> V (in dbSNP:rs453140).
FT                                /FTId=VAR_042286.
FT   VARIANT    1566   1566       T -> M (in dbSNP:rs56217040).
FT                                /FTId=VAR_042287.
FT   VARIANT    1601   1601       A -> T (in dbSNP:rs55706639).
FT                                /FTId=VAR_042288.
FT   VARIANT    1792   1792       R -> H (in a colorectal cancer sample;
FT                                somatic mutation).
FT                                /FTId=VAR_035531.
FT   VARIANT    1930   1930       V -> M (in a colorectal cancer sample;
FT                                somatic mutation).
FT                                /FTId=VAR_035532.
FT   VARIANT    2090   2090       E -> K (in a colorectal cancer sample;
FT                                somatic mutation).
FT                                /FTId=VAR_035533.
FT   VARIANT    2106   2106       D -> E (in dbSNP:rs1188721).
FT                                /FTId=VAR_047744.
FT   VARIANT    2116   2116       F -> L (in dbSNP:rs1188722).
FT                                /FTId=VAR_047745.
FT   VARIANT    2314   2314       S -> F (in a breast cancer sample;
FT                                somatic mutation).
FT                                /FTId=VAR_035534.
FT   VARIANT    2529   2529       R -> Q (in dbSNP:rs3795783).
FT                                /FTId=VAR_047746.
FT   VARIANT    2720   2720       V -> M (in dbSNP:rs1188697).
FT                                /FTId=VAR_047747.
FT   VARIANT    2812   2812       R -> W (in dbSNP:rs3795785).
FT                                /FTId=VAR_047748.
FT   VARIANT    3300   3300       A -> T (in dbSNP:rs437129).
FT                                /FTId=VAR_034620.
FT   VARIANT    3372   3372       E -> D (in dbSNP:rs3795789).
FT                                /FTId=VAR_047749.
FT   VARIANT    3373   3373       S -> C (in dbSNP:rs3795790).
FT                                /FTId=VAR_047750.
FT   VARIANT    3389   3389       A -> V.
FT                                /FTId=VAR_042289.
FT   VARIANT    3426   3426       D -> E.
FT                                /FTId=VAR_042290.
FT   VARIANT    3834   3834       R -> G.
FT                                /FTId=VAR_042291.
FT   VARIANT    3983   3983       R -> Q (in a colorectal cancer sample;
FT                                somatic mutation).
FT                                /FTId=VAR_035535.
FT   VARIANT    4039   4039       G -> R (in dbSNP:rs435776).
FT                                /FTId=VAR_047751.
FT   VARIANT    4381   4381       H -> R (in dbSNP:rs1150912).
FT                                /FTId=VAR_034621.
FT   VARIANT    4450   4450       C -> R (in dbSNP:rs1188732).
FT                                /FTId=VAR_034622.
FT   VARIANT    4516   4516       R -> W (in dbSNP:rs11810627).
FT                                /FTId=VAR_059429.
FT   VARIANT    4534   4534       R -> H (in dbSNP:rs4653942).
FT                                /FTId=VAR_026410.
FT   VARIANT    4558   4558       R -> H (in a colorectal cancer sample;
FT                                somatic mutation).
FT                                /FTId=VAR_035536.
FT   VARIANT    4642   4642       S -> C (in dbSNP:rs1188729).
FT                                /FTId=VAR_056102.
FT   VARIANT    4662   4662       R -> C (in dbSNP:rs3795800).
FT                                /FTId=VAR_056103.
FT   VARIANT    4666   4666       G -> S (in dbSNP:rs3795801).
FT                                /FTId=VAR_056104.
FT   VARIANT    4810   4810       R -> Q (in a breast cancer sample;
FT                                somatic mutation).
FT                                /FTId=VAR_035537.
FT   VARIANT    4823   4823       A -> S.
FT                                /FTId=VAR_042292.
FT   VARIANT    4962   4962       D -> G (in dbSNP:rs373610).
FT                                /FTId=VAR_056105.
FT   VARIANT    5071   5071       A -> T (in a breast cancer sample;
FT                                somatic mutation).
FT                                /FTId=VAR_035538.
FT   VARIANT    5269   5269       L -> V (in dbSNP:rs369909).
FT                                /FTId=VAR_056106.
FT   VARIANT    5575   5575       R -> H (in dbSNP:rs3795809).
FT                                /FTId=VAR_056107.
FT   VARIANT    5598   5598       R -> Q.
FT                                /FTId=VAR_042293.
FT   VARIANT    5891   5891       Q -> E (in dbSNP:rs1188710).
FT                                /FTId=VAR_056108.
FT   VARIANT    6473   6473       E -> Q.
FT                                /FTId=VAR_042294.
FT   VARIANT    7172   7172       A -> V (in dbSNP:rs500049).
FT                                /FTId=VAR_056109.
FT   CONFLICT    888    888       V -> A (in Ref. 1; CAC85746).
FT   CONFLICT    895    895       L -> P (in Ref. 1; CAC85746).
FT   CONFLICT    897    897       R -> C (in Ref. 1; CAC85746).
FT   CONFLICT    899    900       KL -> EV (in Ref. 1; CAC85746).
FT   CONFLICT    904    904       A -> V (in Ref. 1; CAC85746).
FT   CONFLICT    917    917       A -> D (in Ref. 1; CAC85746).
FT   CONFLICT    919    919       T -> M (in Ref. 1; CAC85746).
FT   CONFLICT    937    938       CM -> HV (in Ref. 1; CAC85746).
FT   CONFLICT    941    941       T -> V (in Ref. 1; CAC85746).
FT   CONFLICT    944    944       T -> M (in Ref. 1; CAC85746).
FT   CONFLICT    952    952       A -> V (in Ref. 1; CAC85746).
FT   CONFLICT    957    957       A -> S (in Ref. 1; CAC85746).
FT   CONFLICT    965    965       G -> R (in Ref. 1; CAC85746).
FT   CONFLICT    969    969       L -> V (in Ref. 1; CAC85746).
FT   CONFLICT    972    972       H -> R (in Ref. 1; CAC85746).
FT   CONFLICT    999    999       S -> N (in Ref. 1; CAC44768).
FT   CONFLICT   1011   1011       T -> A (in Ref. 1; CAC44768).
FT   CONFLICT   1348   1348       A -> V (in Ref. 1; CAC85746).
FT   CONFLICT   1355   1355       L -> P (in Ref. 1; CAC85749).
FT   CONFLICT   1357   1357       H -> R (in Ref. 1; CAC85746).
FT   CONFLICT   1359   1359       K -> E (in Ref. 1; CAC85749).
FT   CONFLICT   1360   1360       V -> L (in Ref. 1; CAC85746).
FT   CONFLICT   1367   1367       I -> S (in Ref. 1; CAC85746/CAC85749).
FT   CONFLICT   1394   1394       S -> L (in Ref. 1; CAC85749).
FT   CONFLICT   1397   1398       RM -> HV (in Ref. 1; CAC85749).
FT   CONFLICT   1397   1397       R -> C (in Ref. 1; CAC85746).
FT   CONFLICT   1401   1401       V -> A (in Ref. 1; CAC85749).
FT   CONFLICT   1401   1401       V -> T (in Ref. 1; CAC85746).
FT   CONFLICT   1413   1413       C -> G (in Ref. 1; CAC85746/CAC85749).
FT   CONFLICT   1417   1417       T -> A (in Ref. 1; CAC85746).
FT   CONFLICT   1428   1428       R -> Q (in Ref. 1; CAC85749).
FT   CONFLICT   1432   1432       S -> H (in Ref. 1; CAC85746).
FT   CONFLICT   1445   1445       E -> D (in Ref. 1; CAC85750).
FT   CONFLICT   1455   1455       Q -> E (in Ref. 1; CAC85750).
FT   CONFLICT   1458   1458       A -> T (in Ref. 1; CAC85750).
FT   CONFLICT   1461   1461       T -> M (in Ref. 1; CAC85750).
FT   CONFLICT   1524   1524       H -> R (in Ref. 1; CAC85749).
FT   CONFLICT   1526   1526       H -> Q (in Ref. 1; CAC85749).
FT   CONFLICT   1580   1582       VRM -> MRV (in Ref. 1; CAC85750).
FT   CONFLICT   1607   1607       K -> E (in Ref. 1; CAC85750).
FT   CONFLICT   1610   1610       D -> G (in Ref. 1; CAC85750).
FT   CONFLICT   1633   1633       H -> C (in Ref. 1; CAC85750).
FT   CONFLICT   1653   1655       AQT -> GQM (in Ref. 1; CAC85750).
FT   CONFLICT   1673   1674       RV -> HM (in Ref. 1; CAC85750).
FT   CONFLICT   1677   1679       VGC -> SGY (in Ref. 1; CAC85750).
FT   CONFLICT   1692   1692       E -> D (in Ref. 1; CAC44768/CAC85750).
FT   CONFLICT   1704   1704       Q -> R (in Ref. 1; CAC44768/CAC85750).
FT   CONFLICT   1710   1710       Q -> H (in Ref. 1; CAC44768/CAC85750).
FT   CONFLICT   1848   1848       L -> P (in Ref. 1; CAC44768).
FT   CONFLICT   2014   2014       P -> A (in Ref. 1; CAC85750).
FT   CONFLICT   3126   3126       V -> M (in Ref. 1; CAC44768).
FT   CONFLICT   4155   4155       T -> TG (in Ref. 3; CAC85752).
FT   CONFLICT   4489   4489       H -> Q (in Ref. 1; CAC44768).
FT   CONFLICT   4959   4959       T -> A (in Ref. 1; CAC44768).
FT   CONFLICT   5243   5243       S -> ST (in Ref. 1; CAC85753).
FT   CONFLICT   5391   5391       S -> F (in Ref. 4; BAB13465).
FT   CONFLICT   5499   5500       LE -> FQ (in Ref. 1; CAC44768).
FT   CONFLICT   6115   6115       R -> L (in Ref. 1; CAC44768).
FT   CONFLICT   6570   6570       Q -> E (in Ref. 3; CAJ76912).
FT   CONFLICT   6710   6711       PS -> SG (in Ref. 3; CAJ76912).
FT   STRAND     1634   1639
FT   STRAND     1644   1646
FT   STRAND     1653   1655
FT   STRAND     1658   1661
FT   STRAND     1670   1677
FT   STRAND     1680   1685
FT   TURN       1690   1692
FT   STRAND     1696   1700
FT   STRAND     1707   1712
FT   STRAND     2745   2750
FT   STRAND     2753   2758
FT   STRAND     2771   2776
FT   STRAND     2784   2788
FT   STRAND     2791   2796
FT   TURN       2801   2803
FT   STRAND     2807   2811
FT   STRAND     2814   2818
FT   STRAND     2820   2823
FT   STRAND     2829   2831
FT   STRAND     2836   2838
FT   STRAND     2844   2846
FT   STRAND     2849   2854
FT   STRAND     2859   2863
FT   STRAND     2869   2877
FT   STRAND     2880   2887
FT   TURN       2890   2892
FT   STRAND     2894   2899
FT   STRAND     2904   2911
FT   STRAND     2925   2928
FT   STRAND     2931   2938
FT   STRAND     2947   2952
FT   STRAND     2957   2966
FT   STRAND     2969   2976
FT   TURN       2979   2981
FT   STRAND     2983   2988
FT   STRAND     2996   3001
FT   STRAND     3006   3009
FT   STRAND     3013   3017
FT   STRAND     3027   3030
FT   STRAND     3037   3042
FT   STRAND     3048   3050
FT   TURN       3057   3059
FT   STRAND     3063   3065
FT   TURN       3070   3072
FT   STRAND     3074   3080
FT   STRAND     3087   3092
FT   STRAND     3187   3189
FT   STRAND     3194   3197
FT   STRAND     3202   3210
FT   STRAND     3216   3219
FT   STRAND     3227   3235
FT   STRAND     3238   3243
FT   HELIX      3248   3250
FT   STRAND     3252   3258
FT   STRAND     3261   3270
FT   STRAND     3371   3374
FT   STRAND     3386   3388
FT   STRAND     3392   3397
FT   STRAND     3402   3405
FT   STRAND     3407   3410
FT   STRAND     3412   3421
FT   TURN       3424   3426
FT   STRAND     3430   3433
FT   STRAND     3438   3441
FT   STRAND     3443   3446
FT   STRAND     3452   3454
FT   STRAND     3459   3462
FT   STRAND     3467   3475
FT   STRAND     3480   3483
FT   STRAND     3490   3509
FT   TURN       3512   3514
FT   STRAND     3516   3522
FT   STRAND     3525   3534
FT   STRAND     3555   3564
FT   STRAND     3568   3575
FT   STRAND     3578   3581
FT   STRAND     3583   3587
FT   STRAND     3590   3597
FT   TURN       3600   3602
FT   STRAND     3604   3610
FT   STRAND     3613   3618
FT   STRAND     3620   3622
FT   STRAND     3628   3630
FT   STRAND     3643   3651
FT   STRAND     3656   3663
FT   STRAND     3667   3675
FT   STRAND     3678   3683
FT   STRAND     3692   3698
FT   STRAND     3701   3709
FT   STRAND     3716   3718
FT   STRAND     3723   3726
FT   STRAND     3731   3739
FT   STRAND     3744   3751
FT   STRAND     3754   3757
FT   STRAND     3759   3763
FT   STRAND     3766   3773
FT   TURN       3776   3778
FT   STRAND     3780   3788
FT   STRAND     3790   3798
FT   STRAND     3811   3814
FT   STRAND     3820   3824
FT   STRAND     3826   3828
FT   STRAND     3831   3837
FT   STRAND     3842   3848
FT   STRAND     3852   3861
FT   HELIX      3864   3866
FT   STRAND     3870   3874
FT   STRAND     3877   3880
FT   STRAND     3883   3886
FT   STRAND     5604   5609
FT   STRAND     5628   5636
FT   STRAND     5639   5644
FT   STRAND     5654   5657
FT   HELIX      5659   5661
FT   STRAND     5662   5665
SQ   SEQUENCE   7968 AA;  868484 MW;  46550B34565CAC76 CRC64;
     MDQPQFSGAP RFLTRPKAFV VSVGKDATLS CQIVGNPTPQ VSWEKDQQPV AAGARFRLAQ
     DGDLYRLTIL DLALGDSGQY VCRARNAIGE AFAAVGLQVD AEAACAEQAP HFLLRPTSIR
     VREGSEATFR CRVGGSPRPA VSWSKDGRRL GEPDGPRVRV EELGEASALR IRAARPRDGG
     TYEVRAENPL GAASAAAALV VDSDAADTAS RPGTSTAALL AHLQRRREAM RAEGAPASPP
     STGTRTCTVT EGKHARLSCY VTGEPKPETV WKKDGQLVTE GRRHVVYEDA QENFVLKILF
     CKQSDRGLYT CTASNLVGQT YSSVLVVVRE PAVPFKKRLQ DLEVREKESA TFLCEVPQPS
     TEAAWFKEET RLWASAKYGI EEEGTERRLT VRNVSADDDA VYICETPEGS RTVAELAVQG
     NLLRKLPRKT AVRVGDTAMF CVELAVPVGP VHWLRNQEEV VAGGRVAISA EGTRHTLTIS
     QCCLEDVGQV AFMAGDCQTS TQFCVSAPRK PPLQPPVDPV VKARMESSVI LSWSPPPHGE
     RPVTIDGYLV EKKKLGTYTW IRCHEAEWVA TPELTVADVA EEGNFQFRVS ALNSFGQSPY
     LEFPGTVHLA PKLAVRTPLK AVQAVEGGEV TFSVDLTVAS AGEWFLDGQA LKASSVYEIH
     CDRTRHTLTI REVPASLHGA QLKFVANGIE SSIRMEVRAA PGLTANKPPA AAAREVLARL
     HEEAQLLAEL SDQAAAVTWL KDGRTLSPGP KYEVQASAGR RVLLVRDVAR DDAGLYECVS
     RGGRIAYQLS VQGLARFLHK DMAGSCVDAV AGGPAQFECE TSEAHVHVHW YKDGMELGHS
     GERFLQEDVG TRHRLVAATV TRQDEGTYSC RVGEDSVDFR LRVSEPKVVF AKEQLARRKL
     QAEAGASATL SCEVAQAQTE VTWYKDGKKL SSSSKVCMEA TGCTRRLVVQ QAGQADAGEY
     SCEAGGQRLS FHLDVKEPKV VFAKDQVAHS EVQAEAGASA TLSCEVAQAQ TEVMWYKDGK
     KLSSSLKVHV EAKGCRRRLV VQQAGKTDAG DYSCEARGQR VSFRLHITEP KMMFAKEQSV
     HNEVQAEAGA SAMLSCEVAQ AQTEVTWYKD GKKLSSSSKV GMEVKGCTRR LVLPQAGKAD
     AGEYSCEAGG QRVSFHLHIT EPKGVFAKEQ SVHNEVQAEA GTTAMLSCEV AQPQTEVTWY
     KDGKKLSSSS KVRMEVKGCT RRLVVQQVGK ADAGEYSCEA GGQRVSFQLH ITEPKAVFAK
     EQLVHNEVRT EAGASATLSC EVAQAQTEVT WYKDGKKLSS SSKVRIEAAG CMRQLVVQQA
     GQADAGEYTC EAGGQRLSFH LDVSEPKAVF AKEQLAHRKV QAEAGAIATL SCEVAQAQTE
     VTWYKDGKKL SSSSKVRMEA VGCTRRLVVQ QACQADTGEY SCEAGGQRLS FSLDVAEPKV
     VFAKEQPVHR EVQAQAGAST TLSCEVAQAQ TEVMWYKDGK KLSFSSKVRM EAVGCTRRLV
     VQQAGQAVAG EYSCEAGSQR LSFHLHVAEP KAVFAKEQPA SREVQAEAGT SATLSCEVAQ
     AQTEVTWYKD GKKLSSSSKV RMEAVGCTRR LVVQEAGQAD AGEYSCKAGD QRLSFHLHVA
     EPKVVFAKEQ PAHREVQAEA GASATLSCEV AQAQTEVTWY KDGKKLSSSS KVRVEAVGCT
     RRLVVQQAGQ AEAGEYSCEA GGQQLSFRLQ VAELEPQISE RPCRREPLVV KEHEDIILTA
     TLATPSAATV TWLKDGVEIR RSKRHETASQ GDTHTLTVHG AQVLDSAIYS CRVGAEGQDF
     PVQVEEVAAK FCRLLEPVCG ELGGTVTLAC ELSPACAEVV WRCGNTQLRV GKRFQMVAEG
     PVRSLTVLGL RAEDAGEYVC ESRDDHTSAQ LTVSVPRVVK FMSGLSTVVA EEGGEATFQC
     VVSPSDVAVV WFRDGALLQP SEKFAISQSG ASHSLTISDL VLEDAGQITV EAEGASSSAA
     LRVREAPVLF KKKLEPQTVE ERSSVTLEVE LTRPWPELRW TRNATALAPG KNVEIHAEGA
     RHRLVLHNVG FADRGFFGCE TPDDKTQAKL TVEMRQVRLV RGLQAVEARE QGTATMEVQL
     SHADVDGSWT RDGLRFQQGP TCHLAVRGPM HTLTLSGLRP EDSGLMVFKA EGVHTSARLV
     VTELPVSFSR PLQDVVTTEK EKVTLECELS RPNVDVRWLK DGVELRAGKT MAIAAQGACR
     SLTIYRCEFA DQGVYVCDAH DAQSSASVKV QGRTYTLIYR RVLAEDAGEI QFVAENAESR
     AQLRVKELPV TLVRPLRDKI AMEKHRGVLE CQVSRASAQV RWFKGSQELQ PGPKYELVSD
     GLYRKLIISD VHAEDEDTYT CDAGDVKTSA QFFVEEQSIT IVRGLQDVTV MEPAPAWFEC
     ETSIPSVRPP KWLLGKTVLQ AGGNVGLEQE GTVHRLMLRR TCSTMTGPVH FTVGKSRSSA
     RLVVSDIPVV LTRPLEPKTG RELQSVVLSC DFRPAPKAVQ WYKDDTPLSP SEKFKMSLEG
     QMAELRILRL MPADAGVYRC QAGSAHSSTE VTVEAREVTV TGPLQDAEAT EEGWASFSCE
     LSHEDEEVEW SLNGMPLYND SFHEISHKGR RHTLVLKSIQ RADAGIVRAS SLKVSTSARL
     EVRVKPVVFL KALDDLSAEE RGTLALQCEV SDPEAHVVWR KDGVQLGPSD KYDFLHTAGT
     RGLVVHDVSP EDAGLYTCHV GSEETRARVR VHDLHVGITK RLKTMEVLEG ESCSFECVLS
     HESASDPAMW TVGGKTVGSS SRFQATRQGR KYILVVREAA PSDAGEVVFS VRGLTSKASL
     IVRERPAAII KPLEDQWVAP GEDVELRCEL SRAGTPVHWL KDRKAIRKSQ KYDVVCEGTM
     AMLVIRGASL KDAGEYTCEV EASKSTASLH VEEKANCFTE ELTNLQVEEK GTAVFTCKTE
     HPAATVTWRK GLLELRASGK HQPSQEGLTL RLTISALEKA DSDTYTCDIG QAQSRAQLLV
     QGRRVHIIED LEDVDVQEGS SATFRCRISP ANYEPVHWFL DKTPLHANEL NEIDAQPGGY
     HVLTLRQLAL KDSGTIYFEA GDQRASAALR VTEKPSVFSR ELTDATITEG EDLTLVCETS
     TCDIPVCWTK DGKTLRGSAR CQLSHEGHRA QLLITGATLQ DSGRYKCEAG GACSSSIVRV
     HARPVRFQEA LKDLEVLEGG AATLRCVLSS VAAPVKWCYG NNVLRPGDKY SLRQEGAMLE
     LVVRNLRPQD SGRYSCSFGD QTTSATLTVT ALPAQFIGKL RNKEATEGAT ATLRCELSKA
     APVEWRKGSE TLRDGDRYCL RQDGAMCELQ IRGLAMVDAA EYSCVCGEER TSASLTIRPM
     PAHFIGRLRH QESIEGATAT LRCELSKAAP VEWRKGRESL RDGDRHSLRQ DGAVCELQIC
     GLAVADAGEY SCVCGEERTS ATLTVKALPA KFTEGLRNEE AVEGATAMLW CELSKVAPVE
     WRKGPENLRD GDRYILRQEG TRCELQICGL AMADAGEYLC VCGQERTSAT LTIRALPARF
     IEDVKNQEAR EGATAVLQCE LNSAAPVEWR KGSETLRDGD RYSLRQDGTK CELQIRGLAM
     ADTGEYSCVC GQERTSAMLT VRALPIKFTE GLRNEEATEG ATAVLRCELS KMAPVEWWKG
     HETLRDGDRH SLRQDGARCE LQIRGLVAED AGEYLCMCGK ERTSAMLTVR AMPSKFIEGL
     RNEEATEGDT ATLWCELSKA APVEWRKGHE TLRDGDRHSL RQDGSRCELQ IRGLAVVDAG
     EYSCVCGQER TSATLTVRAL PARFIEDVKN QEAREGATAV LQCELSKAAP VEWRKGSETL
     RGGDRYSLRQ DGTRCELQIH GLSVADTGEY SCVCGQERTS ATLTVRAPQP VFREPLQSLQ
     AEEGSTATLQ CELSEPTATV VWSKGGLQLQ ANGRREPRLQ GCTAELVLQD LQREDTGEYT
     CTCGSQATSA TLTVTAAPVR FLRELQHQEV DEGGTAHLCC ELSRAGASVE WRKGSLQLFP
     CAKYQMVQDG AAAELLVRGV EQEDAGDYTC DTGHTQSMAS LSVRVPRPKF KTRLQSLEQE
     TGDIARLCCQ LSDAESGAVV QWLKEGVELH AGPKYEMRSQ GATRELLIHQ LEAKDTGEYA
     CVTGGQKTAA SLRVTEPEVT IVRGLVDAEV TADEDVEFSC EVSRAGATGV QWCLQGLPLQ
     SNEVTEVAVR DGRIHTLRLK GVTPEDAGTV SFHLGNHASS AQLTVRAPEV TILEPLQDVQ
     LSEGQDASFQ CRLSRASGQE ARWALGGVPL QANEMNDITV EQGTLHLLTL HKVTLEDAGT
     VSFHVGTCSS EAQLKVTAKN TVVRGLENVE ALEGGEALFE CQLSQPEVAA HTWLLDDEPV
     HTSENAEVVF FENGLRHLLL LKNLRPQDSC RVTFLAGDMV TSAFLTVRGW RLEILEPLKN
     AAVRAGAQAC FTCTLSEAVP VGEASWYING AAVQPDDSDW TVTADGSHHA LLLRSAQPHH
     AGEVTFACRD AVASARLTVL GLPDPPEDAE VVARSSHTVT LSWAAPMSDG GGGLCGYRVE
     VKEGATGQWR LCHELVPGPE CVVDGLAPGE TYRFRVAAVG PVGAGEPVHL PQTVRLAEPP
     KPVPPQPSAP ESRQVAAGED VSLELEVVAE AGEVIWHKGM ERIQPGGRFE VVSQGRQQML
     VIKGFTAEDQ GEYHCGLAQG SICPAAATFQ VALSPASVDE APQPSLPPEA AQEGDLHLLW
     EALARKRRMS REPTLDSISE LPEEDGRSQR LPQEAEEVAP DLSEGYSTAD ELARTGDADL
     SHTSSDDESR AGTPSLVTYL KKAGRPGTSP LASKVGAPAA PSVKPQQQQE PLAAVRPPLG
     DLSTKDLGDP SMDKAAVKIQ AAFKGYKVRK EMKQQEGPMF SHTFGDTEAQ VGDALRLECV
     VASKADVRAR WLKDGVELTD GRHHHIDQLG DGTCSLLITG LDRADAGCYT CQVSNKFGQV
     THSACVVVSG SESEAESSSG GELDDAFRRA ARRLHRLFRT KSPAEVSDEE LFLSADEGPA
     EPEEPADWQT YREDEHFICI RFEALTEARQ AVTRFQEMFA TLGIGVEIKL VEQGPRRVEM
     CISKETPAPV VPPEPLPSLL TSDAAPVFLT ELQNQEVQDG YPVSFDCVVT GQPMPSVRWF
     KDGKLLEEDD HYMINEDQQG GHQLIITAVV PADMGVYRCL AENSMGVSST KAELRVDLTS
     TDYDTAADAT ESSSYFSAQG YLSSREQEGT ESTTDEGQLP QVVEELRDLQ VAPGTRLAKF
     QLKVKGYPAP RLYWFKDGQP LTASAHIRMT DKKILHTLEI ISVTREDSGQ YAAYISNAMG
     AAYSSARLLV RGPDEPEEKP ASDVHEQLVP PRMLERFTPK KVKKGSSITF SVKVEGRPVP
     TVHWLREEAE RGVLWIGPDT PGYTVASSAQ QHSLVLLDVG RQHQGTYTCI ASNAAGQALC
     SASLHVSGLP KVEEQEKVKE ALISTFLQGT TQAISAQGLE TASFADLGGQ RKEEPLAAKE
     ALGHLSLAEV GTEEFLQKLT SQITEMVSAK ITQAKLQVPG GDSDEDSKTP SASPRHGRSR
     PSSSIQESSS ESEDGDARGE IFDIYVVTAD YLPLGAEQDA ITLREGQYVE VLDAAHPLRW
     LVRTKPTKSS PSRQGWVSPA YLDRRLKLSP EWGAAEAPEF PGEAVSEDEY KARLSSVIQE
     LLSSEQAFVE ELQFLQSHHL QHLERCPHVP IAVAGQKAVI FRNVRDIGRF HSSFLQELQQ
     CDTDDDVAMC FIKNQAAFEQ YLEFLVGRVQ AESVVVSTAI QEFYKKYAEE ALLAGDPSQP
     PPPPLQHYLE QPVERVQRYQ ALLKELIRNK ARNRQNCALL EQAYAVVSAL PQRAENKLHV
     SLMENYPGTL QALGEPIRQG HFIVWEGAPG ARMPWKGHNR HVFLFRNHLV ICKPRRDSRT
     DTVSYVFRNM MKLSSIDLND QVEGDDRAFE VWQEREDSVR KYLLQARTAI IKSSWVKEIC
     GIQQRLALPV WRPPDFEEEL ADCTAELGET VKLACRVTGT PKPVISWYKD GKAVQVDPHH
     ILIEDPDGSC ALILDSLTGV DSGQYMCFAA SAAGNCSTLG KILVQVPPRF VNKVRASPFV
     EGEDAQFTCT IEGAPYPQIR WYKDGALLTT GNKFQTLSEP RSGLLVLVIR AASKEDLGLY
     ECELVNRLGS ARASAELRIQ SPMLQAQEQC HREQLVAAVE DTTLERADQE VTSVLKRLLG
     PKAPGPSTGD LTGPGPCPRG APALQETGSQ PPVTGTSEAP AVPPRVPQPL LHEGPEQEPE
     AIARAQEWTV PIRMEGAAWP GAGTGELLWD VHSHVVRETT QRTYTYQAID THTARPPSMQ
     VTIEDVQAQT GGTAQFEAII EGDPQPSVTW YKDSVQLVDS TRLSQQQEGT TYSLVLRHVA
     SKDAGVYTCL AQNTGGQVLC KAELLVLGGD NEPDSEKQSH RRKLHSFYEV KEEIGRGVFG
     FVKRVQHKGN KILCAAKFIP LRSRTRAQAY RERDILAALS HPLVTGLLDQ FETRKTLILI
     LELCSSEELL DRLYRKGVVT EAEVKVYIQQ LVEGLHYLHS HGVLHLDIKP SNILMVHPAR
     EDIKICDFGF AQNITPAELQ FSQYGSPEFV SPEIIQQNPV SEASDIWAMG VISYLSLTCS
     SPFAGESDRA TLLNVLEGRV SWSSPMAAHL SEDAKDFIKA TLQRAPQARP SAAQCLSHPW
     FLKSMPAEEA HFINTKQLKF LLARSRWQRS LMSYKSILVM RSIPELLRGP PDSPSLGVAR
     HLCRDTGGSS SSSSSSDNEL APFARAKSLP PSPVTHSPLL HPRGFLRPSA SLPEEAEASE
     RSTEAPAPPA SPEGAGPPAA QGCVPRHSVI RSLFYHQAGE SPEHGALAPG SRRHPARRRH
     LLKGGYIAGA LPGLREPLME HRVLEEEAAR EEQATLLAKA PSFETALRLP ASGTHLAPGH
     SHSLEHDSPS TPRPSSEACG EAQRLPSAPS GGAPIRDMGH PQGSKQLPST GGHPGTAQPE
     RPSPDSPWGQ PAPFCHPKQG SAPQEGCSPH PAVAPCPPGS FPPGSCKEAP LVPSSPFLGQ
     PQAPPAPAKA SPPLDSKMGP GDISLPGRPK PGPCSSPGSA SQASSSQVSS LRVGSSQVGT
     EPGPSLDAEG WTQEAEDLSD STPTLQRPQE QATMRKFSLG GRGGYAGVAG YGTFAFGGDA
     GGMLGQGPMW ARIAWAVSQS EEEEQEEARA ESQSEEQQEA RAESPLPQVS ARPVPEVGRA
     PTRSSPEPTP WEDIGQVSLV QIRDLSGDAE AADTISLDIS EVDPAYLNLS DLYDIKYLPF
     EFMIFRKVPK SAQPEPPSPM AEEELAEFPE PTWPWPGELG PHAGLEITEE SEDVDALLAE
     AAVGRKRKWS SPSRSLFHFP GRHLPLDEPA ELGLRERVKA SVEHISRILK GRPEGLEKEG
     PPRKKPGLAS FRLSGLKSWD RAPTFLRELS DETVVLGQSV TLACQVSAQP AAQATWSKDG
     APLESSSRVL ISATLKNFQL LTILVVVAED LGVYTCSVSN ALGTVTTTGV LRKAERPSSS
     PCPDIGEVYA DGVLLVWKPV ESYGPVTYIV QCSLEGGSWT TLASDIFDCC YLTSKLSRGG
     TYTFRTACVS KAGMGPYSSP SEQVLLGGPS HLASEEESQG RSAQPLPSTK TFAFQTQIQR
     GRFSVVRQCW EKASGRALAA KIIPYHPKDK TAVLREYEAL KGLRHPHLAQ LHAAYLSPRH
     LVLILELCSG PELLPCLAER ASYSESEVKD YLWQMLSATQ YLHNQHILHL DLRSENMIIT
     EYNLLKVVDL GNAQSLSQEK VLPSDKFKDY LETMAPELLE GQGAVPQTDI WAIGVTAFIM
     LSAEYPVSSE GARDLQRGLR KGLVRLSRCY AGLSGGAVAF LRSTLCAQPW GRPCASSCLQ
     CPWLTEEGPA CSRPAPVTFP TARLRVFVRN REKRRALLYK RHNLAQVR
//
DBGET integrated database retrieval system