GenomeNet

Database: UniProt
Entry: Q8BYH0
LinkDB: Q8BYH0
Original site: Q8BYH0 
ID   DRGX_MOUSE              Reviewed;         263 AA.
AC   Q8BYH0; A2RTS1; B2ZIF3; B2ZIF4; Q8K3F8;
DT   05-SEP-2006, integrated into UniProtKB/Swiss-Prot.
DT   11-JAN-2011, sequence version 2.
DT   19-MAR-2014, entry version 92.
DE   RecName: Full=Dorsal root ganglia homeobox protein;
DE   AltName: Full=Dorsal root ganglion 11;
DE   AltName: Full=Homeobox protein DRG11;
DE   AltName: Full=Paired-related homeobox protein-like 1;
GN   Name=Drgx; Synonyms=Drg11, Prrxl1;
OS   Mus musculus (Mouse).
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;
OC   Muroidea; Muridae; Murinae; Mus; Mus.
OX   NCBI_TaxID=10090;
RN   [1]
RP   NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), AND TISSUE SPECIFICITY.
RX   PubMed=19598127; DOI=10.1387/ijdb.072507sr;
RA   Rebelo S., Lopes C., Lima D., Reguenga C.;
RT   "Expression of a Prrxl1 alternative splice variant during the
RT   development of the mouse nociceptive system.";
RL   Int. J. Dev. Biol. 53:1089-1095(2009).
RN   [2]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
RC   STRAIN=C57BL/6J; TISSUE=Spinal cord;
RX   PubMed=16141072; DOI=10.1126/science.1112014;
RA   Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N.,
RA   Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K.,
RA   Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M.,
RA   Davis M.J., Wilming L.G., Aidinis V., Allen J.E.,
RA   Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L.,
RA   Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M.,
RA   Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R.,
RA   Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G.,
RA   di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G.,
RA   Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M.,
RA   Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E.,
RA   Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N.,
RA   Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T.,
RA   Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H.,
RA   Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K.,
RA   Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J.,
RA   Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L.,
RA   Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K.,
RA   Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P.,
RA   Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O.,
RA   Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G.,
RA   Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M.,
RA   Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C.,
RA   Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y.,
RA   Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B.,
RA   Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K.,
RA   Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A.,
RA   Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K.,
RA   Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C.,
RA   Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J.,
RA   Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y.,
RA   Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T.,
RA   Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N.,
RA   Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N.,
RA   Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S.,
RA   Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J.,
RA   Hayashizaki Y.;
RT   "The transcriptional landscape of the mammalian genome.";
RL   Science 309:1559-1563(2005).
RN   [3]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
RC   TISSUE=Brain;
RX   PubMed=15489334; DOI=10.1101/gr.2596504;
RG   The MGC Project Team;
RT   "The status, quality, and expansion of the NIH full-length cDNA
RT   project: the Mammalian Gene Collection (MGC).";
RL   Genome Res. 14:2121-2127(2004).
RN   [4]
RP   NUCLEOTIDE SEQUENCE [MRNA] OF 10-104.
RC   STRAIN=C57BL/6J;
RX   PubMed=15099678; DOI=10.1016/j.neuroscience.2004.02.006;
RA   Vogelaar C.F., Hoekman M.F., Brakkee J.H., Bogerd J., Burbach J.P.;
RT   "Developmental regulation of homeobox gene expression in dorsal root
RT   ganglion neurons is not recapitulated during regeneration of the
RT   crushed sciatic nerve.";
RL   Neuroscience 125:645-650(2004).
RN   [5]
RP   FUNCTION, TISSUE SPECIFICITY, DEVELOPMENTAL STAGE, AND DISRUPTION
RP   PHENOTYPE.
RX   PubMed=11498051; DOI=10.1016/S0896-6273(01)00341-5;
RA   Chen Z.-F., Rebelo S., White F., Malmberg A.B., Baba H., Lima D.,
RA   Woolf C.J., Basbaum A.I., Anderson D.J.;
RT   "The paired homeodomain protein DRG11 is required for the projection
RT   of cutaneous sensory afferent fibers to the dorsal spinal cord.";
RL   Neuron 31:59-73(2001).
RN   [6]
RP   INTERACTION WITH RGMB AND DISRUPTION PHENOTYPE.
RX   PubMed=14985445; DOI=10.1523/JNEUROSCI.4115-03.2004;
RA   Samad T.A., Srinivasan A., Karchewski L.A., Jeong S.-J.,
RA   Campagna J.A., Ji R.-R., Fabrizio D.A., Zhang Y., Lin H.Y., Bell E.,
RA   Woolf C.J.;
RT   "DRAGON: a member of the repulsive guidance molecule-related family of
RT   neuronal- and muscle-expressed membrane proteins is regulated by DRG11
RT   and has neuronal adhesive properties.";
RL   J. Neurosci. 24:2027-2036(2004).
CC   -!- FUNCTION: Transcription factor required for the formation of
CC       correct projections from nociceptive sensory neurons to the dorsal
CC       horn of the spinal cord and normal perception of pain.
CC   -!- SUBUNIT: Interacts with RGMB.
CC   -!- SUBCELLULAR LOCATION: Nucleus (By similarity).
CC   -!- ALTERNATIVE PRODUCTS:
CC       Event=Alternative splicing; Named isoforms=2;
CC       Name=1;
CC         IsoId=Q8BYH0-1; Sequence=Displayed;
CC       Name=2; Synonyms=Prrxl1-B;
CC         IsoId=Q8BYH0-2; Sequence=VSP_040392;
CC   -!- TISSUE SPECIFICITY: Expressed in the dorsal horn of the spinal
CC       cord and dorsal root ganglia. Isoform 1 is higher expressed than
CC       isoform 2 both in the dorsal root ganglia and in the spinal cord.
CC       Isoform 2 is exclusively localized in neurons primarily involved
CC       in the processing of the pain somatosensory modality.
CC   -!- DEVELOPMENTAL STAGE: First detected at E12.5 in newly generated
CC       neurons adjacent to the ventricular zone of the dorsal spinal
CC       cord. Later expressed in lateral region of the dorsal spinal cord
CC       and dorsal root ganglia at E13.5 with increased levels at E15.5.
CC   -!- DISRUPTION PHENOTYPE: Defects in the projection pattern of
CC       nociceptive sensory neurons to the dorsal horn of the developing
CC       spinal cord leading to reduced sensitivity to painful stimuli.
CC       They die within 3 weeks of birth. Mice lacking Drgx exhibit
CC       reduced expression of Rgmb in dorsal root ganglion sensory
CC       neurons.
CC   -!- SIMILARITY: Belongs to the paired homeobox family.
CC   -!- SIMILARITY: Contains 1 homeobox DNA-binding domain.
CC   -----------------------------------------------------------------------
CC   Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms
CC   Distributed under the Creative Commons Attribution-NoDerivs License
CC   -----------------------------------------------------------------------
DR   EMBL; EU670677; ACD45984.1; -; mRNA.
DR   EMBL; EU670678; ACD45985.1; -; mRNA.
DR   EMBL; AK039633; BAC30405.1; -; mRNA.
DR   EMBL; BC132613; AAI32614.1; -; mRNA.
DR   EMBL; BC145917; AAI45918.1; -; mRNA.
DR   EMBL; AY116506; AAM49062.1; -; mRNA.
DR   RefSeq; NP_001001796.1; NM_001001796.4.
DR   RefSeq; XP_006518473.1; XM_006518410.1.
DR   RefSeq; XP_006518474.1; XM_006518411.1.
DR   RefSeq; XP_006518475.1; XM_006518412.1.
DR   RefSeq; XP_006518476.1; XM_006518413.1.
DR   RefSeq; XP_006518477.1; XM_006518414.1.
DR   RefSeq; XP_006518478.1; XM_006518415.1.
DR   UniGene; Mm.119274; -.
DR   ProteinModelPortal; Q8BYH0; -.
DR   SMR; Q8BYH0; 39-89.
DR   STRING; 10090.ENSMUSP00000064107; -.
DR   PhosphoSite; Q8BYH0; -.
DR   PRIDE; Q8BYH0; -.
DR   Ensembl; ENSMUST00000068938; ENSMUSP00000064107; ENSMUSG00000041730. [Q8BYH0-2]
DR   GeneID; 107751; -.
DR   KEGG; mmu:107751; -.
DR   UCSC; uc007szf.1; mouse. [Q8BYH0-2]
DR   UCSC; uc011zin.1; mouse. [Q8BYH0-1]
DR   CTD; 107751; -.
DR   MGI; MGI:2148204; Prrxl1.
DR   eggNOG; NOG39948; -.
DR   GeneTree; ENSGT00740000115261; -.
DR   HOGENOM; HOG000207632; -.
DR   HOVERGEN; HBG106743; -.
DR   InParanoid; B2ZIF4; -.
DR   OMA; PPARNIN; -.
DR   OrthoDB; EOG7C2R1F; -.
DR   TreeFam; TF351612; -.
DR   NextBio; 359376; -.
DR   PRO; PR:Q8BYH0; -.
DR   Bgee; Q8BYH0; -.
DR   CleanEx; MM_PRRXL1; -.
DR   Genevestigator; Q8BYH0; -.
DR   GO; GO:0005634; C:nucleus; IEA:UniProtKB-SubCell.
DR   GO; GO:0003677; F:DNA binding; IDA:MGI.
DR   GO; GO:0043565; F:sequence-specific DNA binding; IEA:InterPro.
DR   GO; GO:0003700; F:sequence-specific DNA binding transcription factor activity; TAS:MGI.
DR   GO; GO:0007411; P:axon guidance; IMP:MGI.
DR   GO; GO:0009593; P:detection of chemical stimulus; IMP:MGI.
DR   GO; GO:0016048; P:detection of temperature stimulus; IMP:MGI.
DR   GO; GO:0021516; P:dorsal spinal cord development; IMP:MGI.
DR   GO; GO:0001764; P:neuron migration; IMP:MGI.
DR   GO; GO:0050954; P:sensory perception of mechanical stimulus; IMP:MGI.
DR   GO; GO:0006351; P:transcription, DNA-templated; IEA:UniProtKB-KW.
DR   GO; GO:0021559; P:trigeminal nerve development; IMP:MGI.
DR   Gene3D; 1.10.10.60; -; 1.
DR   InterPro; IPR017970; Homeobox_CS.
DR   InterPro; IPR001356; Homeobox_dom.
DR   InterPro; IPR009057; Homeodomain-like.
DR   InterPro; IPR003654; OAR_dom.
DR   Pfam; PF00046; Homeobox; 1.
DR   Pfam; PF03826; OAR; 1.
DR   SMART; SM00389; HOX; 1.
DR   SUPFAM; SSF46689; SSF46689; 1.
DR   PROSITE; PS00027; HOMEOBOX_1; 1.
DR   PROSITE; PS50071; HOMEOBOX_2; 1.
DR   PROSITE; PS50803; OAR; 1.
PE   1: Evidence at protein level;
KW   Alternative splicing; Complete proteome; Developmental protein;
KW   DNA-binding; Homeobox; Nucleus; Reference proteome; Transcription;
KW   Transcription regulation.
FT   CHAIN         1    263       Dorsal root ganglia homeobox protein.
FT                                /FTId=PRO_0000248487.
FT   DNA_BIND     33     92       Homeobox.
FT   MOTIF       204    217       OAR.
FT   VAR_SEQ     176    263       GGPLCSCCVPDPMGLSFLPTYGCQSNRTASVAALRMKAREH
FT                                SEAVLQSANLLPSTSSSPGPASKQAPPEGSQDKTSPTKEQS
FT                                EGEKSV -> DHFRAMLCSGSFGFRGEQTQQRALTPNLYPF
FT                                LIDERCSAVDMTQG (in isoform 2).
FT                                /FTId=VSP_040392.
SQ   SEQUENCE   263 AA;  28717 MW;  412A583BA829105C CRC64;
     MFYFHCPPQL EGTAPFGNHS TGDFDDGFLR RKQRRNRTTF TLQQLEALEA VFAQTHYPDV
     FTREELAMKI NLTEARVQVW FQNRRAKWRK TERGASDQEP GAKEPMAEVT PPPVRNINSP
     PPGDQTRSKK EALEAQQSLG RTVGPTGPFF PSCLPGTLLN TATYAQALSH VASLKGGPLC
     SCCVPDPMGL SFLPTYGCQS NRTASVAALR MKAREHSEAV LQSANLLPST SSSPGPASKQ
     APPEGSQDKT SPTKEQSEGE KSV
//
DBGET integrated database retrieval system