
Database: UniProt
Entry: Q99963
LinkDB: Q99963
Original site: Q99963 
ID   SH3G3_HUMAN             Reviewed;         347 AA.
AC   Q99963; O43553; O43554;
DT   01-DEC-2000, integrated into UniProtKB/Swiss-Prot.
DT   01-MAY-1997, sequence version 1.
DT   15-MAR-2017, entry version 163.
DE   RecName: Full=Endophilin-A3;
DE   AltName: Full=EEN-B2;
DE   AltName: Full=Endophilin-3;
DE   AltName: Full=SH3 domain protein 2C;
DE   AltName: Full=SH3 domain-containing GRB2-like protein 3;
GN   Name=SH3GL3; Synonyms=CNSA3, SH3D2C;
OS   Homo sapiens (Human).
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
OC   Catarrhini; Hominidae; Homo.
OX   NCBI_TaxID=9606;
RN   [1]
RC   TISSUE=Fetal brain;
RX   PubMed=9169142; DOI=10.1006/geno.1997.4645;
RA   Giachino C., Lantelme E., Lanzetti L., Saccone S., Della Valle G.,
RA   Migone N.;
RT   "A novel SH3-containing human gene family preferentially expressed in
RT   the central nervous system.";
RL   Genomics 41:427-434(1997).
RN   [2]
RC   TISSUE=Brain;
RA   So C.W., So C.K.C., Sham M.H., Chan L.C.;
RT   "A family of EEN-like genes coding for SH3-domain containing proteins
RT   are preferentially expressed in human brain.";
RL   Submitted (MAR-1998) to the EMBL/GenBank/DDBJ databases.
RN   [3]
RX   PubMed=9809064; DOI=10.1016/S1097-2765(00)80142-2;
RA   Sittler A., Walter S., Wedemeyer N., Hasenbank R., Scherzinger E.,
RA   Eickhoff H., Bates G.P., Lehrach H., Wanker E.E.;
RT   "SH3GL3 associates with the Huntingtin exon 1 protein and promotes the
RT   formation of polygln-containing protein aggregates.";
RL   Mol. Cell 2:427-436(1998).
RN   [4]
RX   PubMed=10542231; DOI=10.1074/jbc.274.45.32001;
RA   Cestra G., Castagnoli L., Dente L., Minenkova O., Petrelli A.,
RA   Migone N., Hoffmueller U., Schneider-Mergener J., Cesareni G.;
RT   "The SH3 domains of endophilin and amphiphysin bind to the proline-
RT   rich region of synaptojanin 1 at distinct sites that display an
RT   unconventional binding specificity.";
RL   J. Biol. Chem. 274:32001-32007(1999).
RN   [5]
RX   PubMed=15919751; DOI=10.1210/en.2005-0282;
RA   Trevaskis J., Walder K., Foletta V., Kerr-Bayles L., McMillan J.,
RA   Cooper A., Lee S., Bolton K., Prior M., Fahey R., Whitecross K.,
RA   Morton G.J., Schwartz M.W., Collier G.R.;
RT   "Src homology 3-domain growth factor receptor-bound 2-like
RT   (endophilin) interacting protein 1, a novel neuronal protein that
RT   regulates energy balance.";
RL   Endocrinology 146:3757-3764(2005).
RN   [6]
RX   PubMed=18602463; DOI=10.1016/j.cellsig.2008.05.018;
RA   Nonis D., Schmidt M.H., van de Loo S., Eich F., Dikic I., Nowock J.,
RA   Auburger G.;
RT   "Ataxin-2 associates with the endocytosis complex and affects EGF
RT   receptor trafficking.";
RL   Cell. Signal. 20:1725-1739(2008).
RN   [7]
RX   PubMed=19807924; DOI=10.1186/1471-2172-10-53;
RA   Voss M., Lettau M., Janssen O.;
RT   "Identification of SH3 domain interaction partners of human FasL
RT   (CD178) by phage display screening.";
RL   BMC Immunol. 10:53-53(2009).
RN   [8]
RX   PubMed=19545932; DOI=10.1016/j.ejcb.2009.05.001;
RA   Li S., Qiao Y., Di Q., Le X., Zhang L., Zhang X., Zhang C., Cheng J.,
RA   Zong S., Koide S.S., Miao S., Wang L.;
RT   "Interaction of SH3P13 and DYDC1 protein: a germ cell component that
RT   regulates acrosome biogenesis during spermiogenesis.";
RL   Eur. J. Cell Biol. 88:509-520(2009).
RN   [9]
RX   PubMed=21406692; DOI=10.1126/scisignal.2001570;
RA   Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J.,
RA   Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V.,
RA   Blagoev B.;
RT   "System-wide temporal characterization of the proteome and
RT   phosphoproteome of human embryonic stem cell differentiation.";
RL   Sci. Signal. 4:RS3-RS3(2011).
RN   [10]
RX   PubMed=23285027; DOI=10.1371/journal.pone.0052401;
RA   Sanchez-Barrena M.J., Vallis Y., Clatworthy M.R., Doherty G.J.,
RA   Veprintsev D.B., Evans P.R., McMahon H.T.;
RT   "Bin2 is a membrane sculpting N-BAR protein that influences leucocyte
RT   podosomes, motility and phagocytosis.";
RL   PLoS ONE 7:E52401-E52401(2012).
RN   [11]
RC   TISSUE=Erythroleukemia;
RX   PubMed=23186163; DOI=10.1021/pr300630k;
RA   Zhou H., Di Palma S., Preisinger C., Peng M., Polat A.N., Heck A.J.,
RA   Mohammed S.;
RT   "Toward a comprehensive characterization of a human cancer cell
RT   phosphoproteome.";
RL   J. Proteome Res. 12:260-271(2013).
RN   [12]
RG   RIKEN structural genomics initiative (RSGI);
RT   "Crystal structure of BAR domain of endophilin-III.";
RL   Submitted (FEB-2009) to the PDB data bank.
CC   -!- FUNCTION: Implicated in endocytosis. May recruit other proteins to
CC       membranes with high curvature (By similarity). {ECO:0000250}.
CC   -!- SUBUNIT: Interacts with ARC (By similarity). Interacts with DNM1,
CC       SGIP1 and SYNJ1. Interacts with the huntingtin exon 1 protein
CC       (HDEX1P) containing a glutamine repeat in the pathological range
CC       and promotes formation of insoluble polyglutamine-containing
CC       aggregates in vivo. Interacts with DYDC1. Interacts with FASLG.
CC       Interacts with ATX2. Interacts with BIN2. {ECO:0000250,
CC       ECO:0000269|PubMed:10542231, ECO:0000269|PubMed:15919751,
CC       ECO:0000269|PubMed:18602463, ECO:0000269|PubMed:19545932,
CC       ECO:0000269|PubMed:19807924, ECO:0000269|PubMed:23285027,
CC       ECO:0000269|PubMed:9809064}.
CC       Self; NbExp=3; IntAct=EBI-473910, EBI-473910;
CC       Q99700:ATXN2; NbExp=11; IntAct=EBI-473910, EBI-697691;
CC       P42858:HTT; NbExp=9; IntAct=EBI-473910, EBI-466029;
CC       Q70E73:RAPH1; NbExp=4; IntAct=EBI-473910, EBI-3940924;
CC       Q99961:SH3GL1; NbExp=4; IntAct=EBI-473910, EBI-697911;
CC       Q99962:SH3GL2; NbExp=5; IntAct=EBI-473910, EBI-77938;
CC   -!- SUBCELLULAR LOCATION: Cytoplasm {ECO:0000250|UniProtKB:O35180}.
CC       Early endosome membrane {ECO:0000250|UniProtKB:O35180}; Peripheral
CC       membrane protein {ECO:0000250|UniProtKB:O35180}. Note=Associated
CC       with postsynaptic endosomes in hippocampal neurons. Associated
CC       with presynaptic endosomes in olfactory neurons.
CC       {ECO:0000250|UniProtKB:O35180}.
CC       Event=Alternative splicing; Named isoforms=4;
CC       Name=1; Synonyms=EEN-B2-L1;
CC         IsoId=Q99963-1; Sequence=Displayed;
CC       Name=2; Synonyms=EEN-B2-L2;
CC         IsoId=Q99963-2; Sequence=VSP_001441;
CC       Name=3; Synonyms=EEN-B2-L3;
CC         IsoId=Q99963-3; Sequence=VSP_001440;
CC       Name=4; Synonyms=EEN-B2-L4;
CC         IsoId=Q99963-4; Sequence=VSP_001442;
CC   -!- TISSUE SPECIFICITY: Brain and testis.
CC   -!- DOMAIN: An N-terminal amphipathic helix, the BAR domain and a
CC       second amphipathic helix inserted into helix 1 of the BAR domain
CC       (N-BAR domain) induce membrane curvature and bind curved
CC       membranes. {ECO:0000250}.
CC   -!- SIMILARITY: Belongs to the endophilin family. {ECO:0000305}.
DR   EMBL; X99664; CAA67978.1; -; mRNA.
DR   EMBL; AF036269; AAC04765.1; -; mRNA.
DR   EMBL; AF036270; AAC04766.1; -; mRNA.
DR   EMBL; AF036271; AAC04767.1; -; mRNA.
DR   EMBL; AF036272; AAC04768.1; -; mRNA.
DR   CCDS; CCDS10325.2; -. [Q99963-1]
DR   CCDS; CCDS73772.1; -. [Q99963-3]
DR   RefSeq; NP_001288037.1; NM_001301108.1. [Q99963-2]
DR   RefSeq; NP_001288038.1; NM_001301109.1. [Q99963-3]
DR   RefSeq; NP_001311112.1; NM_001324183.1. [Q99963-3]
DR   RefSeq; NP_001311114.1; NM_001324185.1. [Q99963-2]
DR   RefSeq; NP_001311116.1; NM_001324187.1. [Q99963-2]
DR   RefSeq; NP_003018.3; NM_003027.4. [Q99963-1]
DR   RefSeq; XP_011520191.1; XM_011521889.1. [Q99963-3]
DR   RefSeq; XP_016877975.1; XM_017022486.1. [Q99963-2]
DR   UniGene; Hs.270055; -.
DR   PDB; 2EW3; NMR; -; A=285-345.
DR   PDB; 2Z0V; X-ray; 2.49 A; A/B=24-256.
DR   PDBsum; 2EW3; -.
DR   PDBsum; 2Z0V; -.
DR   ProteinModelPortal; Q99963; -.
DR   SMR; Q99963; -.
DR   BioGrid; 112354; 42.
DR   DIP; DIP-34766N; -.
DR   IntAct; Q99963; 44.
DR   MINT; MINT-128532; -.
DR   STRING; 9606.ENSP00000391372; -.
DR   iPTMnet; Q99963; -.
DR   PhosphoSitePlus; Q99963; -.
DR   BioMuta; SH3GL3; -.
DR   DMDM; 12643798; -.
DR   MaxQB; Q99963; -.
DR   PaxDb; Q99963; -.
DR   PeptideAtlas; Q99963; -.
DR   PRIDE; Q99963; -.
DR   DNASU; 6457; -.
DR   Ensembl; ENST00000324537; ENSP00000320092; ENSG00000140600. [Q99963-3]
DR   Ensembl; ENST00000427482; ENSP00000391372; ENSG00000140600. [Q99963-1]
DR   GeneID; 6457; -.
DR   KEGG; hsa:6457; -.
DR   UCSC; uc002bju.4; human. [Q99963-1]
DR   CTD; 6457; -.
DR   DisGeNET; 6457; -.
DR   GeneCards; SH3GL3; -.
DR   H-InvDB; HIX0026775; -.
DR   HGNC; HGNC:10832; SH3GL3.
DR   HPA; HPA039381; -.
DR   HPA; HPA077877; -.
DR   MIM; 603362; gene.
DR   neXtProt; NX_Q99963; -.
DR   OpenTargets; ENSG00000140600; -.
DR   PharmGKB; PA35738; -.
DR   eggNOG; KOG1118; Eukaryota.
DR   GeneTree; ENSGT00550000074464; -.
DR   HOGENOM; HOG000231641; -.
DR   HOVERGEN; HBG052866; -.
DR   InParanoid; Q99963; -.
DR   KO; K11247; -.
DR   OrthoDB; EOG091G16FW; -.
DR   PhylomeDB; Q99963; -.
DR   TreeFam; TF313281; -.
DR   Reactome; R-HSA-182971; EGFR downregulation.
DR   Reactome; R-HSA-6807004; Negative regulation of MET activity.
DR   Reactome; R-HSA-8856825; Cargo recognition for clathrin-mediated endocytosis.
DR   Reactome; R-HSA-8856828; Clathrin-mediated endocytosis.
DR   Reactome; R-HSA-8875360; InlB-mediated entry of Listeria monocytogenes into host cell.
DR   ChiTaRS; SH3GL3; human.
DR   EvolutionaryTrace; Q99963; -.
DR   GeneWiki; SH3GL3; -.
DR   GenomeRNAi; 6457; -.
DR   PRO; PR:Q99963; -.
DR   Proteomes; UP000005640; Chromosome 15.
DR   Bgee; ENSG00000140600; -.
DR   CleanEx; HS_SH3GL3; -.
DR   ExpressionAtlas; Q99963; baseline and differential.
DR   Genevisible; Q99963; HS.
DR   GO; GO:0031901; C:early endosome membrane; IEA:UniProtKB-SubCell.
DR   GO; GO:0070062; C:extracellular exosome; IDA:UniProtKB.
DR   GO; GO:0042802; F:identical protein binding; IPI:IntAct.
DR   GO; GO:0008289; F:lipid binding; IEA:UniProtKB-KW.
DR   GO; GO:0007417; P:central nervous system development; TAS:ProtInc.
DR   GO; GO:0006897; P:endocytosis; IEA:UniProtKB-KW.
DR   GO; GO:0007165; P:signal transduction; TAS:ProtInc.
DR   CDD; cd07615; BAR_Endophilin_A3; 1.
DR   Gene3D; 1.20.1270.60; -; 1.
DR   InterPro; IPR027267; AH/BAR-dom.
DR   InterPro; IPR004148; BAR_dom.
DR   InterPro; IPR028501; Endophilin-A.
DR   InterPro; IPR032469; Endophilin-A3_BAR.
DR   InterPro; IPR011511; SH3_2.
DR   InterPro; IPR001452; SH3_domain.
DR   PANTHER; PTHR10663:SF260; PTHR10663:SF260; 1.
DR   Pfam; PF03114; BAR; 1.
DR   Pfam; PF07653; SH3_2; 1.
DR   SMART; SM00721; BAR; 1.
DR   SMART; SM00326; SH3; 1.
DR   SUPFAM; SSF50044; SSF50044; 1.
DR   PROSITE; PS51021; BAR; 1.
DR   PROSITE; PS50002; SH3; 1.
PE   1: Evidence at protein level;
KW   3D-structure; Alternative splicing; Coiled coil; Complete proteome;
KW   Cytoplasm; Endocytosis; Endosome; Lipid-binding; Membrane;
KW   Phosphoprotein; Reference proteome; SH3 domain.
FT   CHAIN         1    347       Endophilin-A3.
FT                                /FTId=PRO_0000146750.
FT   DOMAIN       18    249       BAR. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00361}.
FT   DOMAIN      285    344       SH3. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00192}.
FT   REGION        1     21       Membrane-binding amphipathic helix.
FT                                {ECO:0000250}.
FT   REGION       60     87       Required for dimerization upon membrane
FT                                association. {ECO:0000250}.
FT   REGION      218    254       Interaction with ARC. {ECO:0000250}.
FT   COILED      181    201       {ECO:0000255}.
FT   MOD_RES     265    265       Phosphoserine.
FT                                {ECO:0000244|PubMed:23186163}.
FT   VAR_SEQ       1     69       Missing (in isoform 2).
FT                                {ECO:0000303|Ref.2}.
FT                                /FTId=VSP_001441.
FT                                (in isoform 3). {ECO:0000303|Ref.2}.
FT                                /FTId=VSP_001440.
FT                                GTFRKIKRETKIKMCRKKIVNIYKLKDQQH (in
FT                                isoform 4). {ECO:0000303|Ref.2}.
FT                                /FTId=VSP_001442.
FT   HELIX        31     58       {ECO:0000244|PDB:2Z0V}.
FT   HELIX        62     69       {ECO:0000244|PDB:2Z0V}.
FT   HELIX        89    104       {ECO:0000244|PDB:2Z0V}.
FT   HELIX       109    138       {ECO:0000244|PDB:2Z0V}.
FT   HELIX       140    148       {ECO:0000244|PDB:2Z0V}.
FT   HELIX       150    172       {ECO:0000244|PDB:2Z0V}.
FT   TURN        173    176       {ECO:0000244|PDB:2Z0V}.
FT   HELIX       180    206       {ECO:0000244|PDB:2Z0V}.
FT   HELIX       209    246       {ECO:0000244|PDB:2Z0V}.
FT   STRAND      289    294       {ECO:0000244|PDB:2EW3}.
FT   STRAND      311    327       {ECO:0000244|PDB:2EW3}.
FT   STRAND      330    335       {ECO:0000244|PDB:2EW3}.
FT   HELIX       336    338       {ECO:0000244|PDB:2EW3}.
FT   STRAND      339    342       {ECO:0000244|PDB:2EW3}.
SQ   SEQUENCE   347 AA;  39285 MW;  D68DA7B28574C4E6 CRC64;
DBGET integrated database retrieval system