GenomeNet

Database: UniProt
Entry: Q9H329
LinkDB: Q9H329
Original site: Q9H329 
ID   E41LB_HUMAN             Reviewed;         900 AA.
AC   Q9H329; Q5T4G5; Q5T4G6; Q9H328; Q9P2V3;
DT   23-APR-2003, integrated into UniProtKB/Swiss-Prot.
DT   14-OCT-2008, sequence version 2.
DT   09-JUL-2014, entry version 110.
DE   RecName: Full=Band 4.1-like protein 4B;
DE   AltName: Full=FERM-containing protein CG1;
DE   AltName: Full=Protein EHM2;
GN   Name=EPB41L4B; Synonyms=EHM2;
OS   Homo sapiens (Human).
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
OC   Catarrhini; Hominidae; Homo.
OX   NCBI_TaxID=9606;
RN   [1]
RP   NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), AND VARIANT THR-816.
RX   PubMed=10603000; DOI=10.1007/s003350010017;
RA   Chadwick B.P., Leyne M., Gill S., Liebert C.B., Mull J., Mezey E.,
RA   Robbins C.M., Pinkett H.W., Makalowska I., Maayan C., Blumenfeld A.,
RA   Axelrod F.B., Brownstein M., Gusella J.F., Slaugenhaupt S.A.;
RT   "Cloning, mapping, and expression of a novel brain-specific transcript
RT   in the familial dysautonomia candidate region on chromosome 9q31.";
RL   Mamm. Genome 11:81-83(2000).
RN   [2]
RP   NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
RX   PubMed=10783258; DOI=10.1006/geno.2000.6154;
RA   Shimizu K., Nagamachi Y., Tani M., Kimura K., Shiroishi T., Wakana S.,
RA   Yokota J.;
RT   "Molecular cloning of a novel NF2/ERM/4.1 superfamily gene, Ehm2, that
RT   is expressed in high-metastatic K1735 murine melanoma cells.";
RL   Genomics 65:113-120(2000).
RN   [3]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
RX   PubMed=15164053; DOI=10.1038/nature02465;
RA   Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E.,
RA   Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C.,
RA   Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S.,
RA   Babbage A.K., Babbage S., Bagguley C.L., Bailey J., Banerjee R.,
RA   Barker D.J., Barlow K.F., Bates K., Beasley H., Beasley O., Bird C.P.,
RA   Bray-Allen S., Brown A.J., Brown J.Y., Burford D., Burrill W.,
RA   Burton J., Carder C., Carter N.P., Chapman J.C., Chen Y., Clarke G.,
RA   Clark S.Y., Clee C.M., Clegg S., Collier R.E., Corby N., Crosier M.,
RA   Cummings A.T., Davies J., Dhami P., Dunn M., Dutta I., Dyer L.W.,
RA   Earthrowl M.E., Faulkner L., Fleming C.J., Frankish A.,
RA   Frankland J.A., French L., Fricker D.G., Garner P., Garnett J.,
RA   Ghori J., Gilbert J.G.R., Glison C., Grafham D.V., Gribble S.,
RA   Griffiths C., Griffiths-Jones S., Grocock R., Guy J., Hall R.E.,
RA   Hammond S., Harley J.L., Harrison E.S.I., Hart E.A., Heath P.D.,
RA   Henderson C.D., Hopkins B.L., Howard P.J., Howden P.J., Huckle E.,
RA   Johnson C., Johnson D., Joy A.A., Kay M., Keenan S., Kershaw J.K.,
RA   Kimberley A.M., King A., Knights A., Laird G.K., Langford C.,
RA   Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C., Lloyd D.M.,
RA   Lovell J., Martin S., Mashreghi-Mohammadi M., Matthews L., McLaren S.,
RA   McLay K.E., McMurray A., Milne S., Nickerson T., Nisbett J.,
RA   Nordsiek G., Pearce A.V., Peck A.I., Porter K.M., Pandian R.,
RA   Pelan S., Phillimore B., Povey S., Ramsey Y., Rand V., Scharfe M.,
RA   Sehra H.K., Shownkeen R., Sims S.K., Skuce C.D., Smith M.,
RA   Steward C.A., Swarbreck D., Sycamore N., Tester J., Thorpe A.,
RA   Tracey A., Tromans A., Thomas D.W., Wall M., Wallis J.M., West A.P.,
RA   Whitehead S.L., Willey D.L., Williams S.A., Wilming L., Wray P.W.,
RA   Young L., Ashurst J.L., Coulson A., Blocker H., Durbin R.M.,
RA   Sulston J.E., Hubbard T., Jackson M.J., Bentley D.R., Beck S.,
RA   Rogers J., Dunham I.;
RT   "DNA sequence and analysis of human chromosome 9.";
RL   Nature 429:369-374(2004).
CC   -!- SUBCELLULAR LOCATION: Cytoplasm, cytoskeleton (By similarity).
CC   -!- ALTERNATIVE PRODUCTS:
CC       Event=Alternative splicing; Named isoforms=2;
CC       Name=1;
CC         IsoId=Q9H329-1; Sequence=Displayed;
CC       Name=2;
CC         IsoId=Q9H329-2; Sequence=VSP_007202, VSP_007203;
CC   -!- SIMILARITY: Contains 1 FERM domain.
CC   -!- SEQUENCE CAUTION:
CC       Sequence=AAG43366.1; Type=Frameshift; Positions=19, 35, 870;
CC       Sequence=AAG43368.1; Type=Frameshift; Positions=19, 35;
CC   -----------------------------------------------------------------------
CC   Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms
CC   Distributed under the Creative Commons Attribution-NoDerivs License
CC   -----------------------------------------------------------------------
DR   EMBL; AF153416; AAG43366.1; ALT_FRAME; mRNA.
DR   EMBL; AF153418; AAG43368.1; ALT_FRAME; mRNA.
DR   EMBL; AB032179; BAA96079.2; -; mRNA.
DR   EMBL; AL359963; CAH71092.1; -; Genomic_DNA.
DR   EMBL; AL358815; CAH71092.1; JOINED; Genomic_DNA.
DR   EMBL; AL359963; CAH71093.1; -; Genomic_DNA.
DR   EMBL; AL358815; CAH71093.1; JOINED; Genomic_DNA.
DR   EMBL; AL358815; CAI15130.1; -; Genomic_DNA.
DR   EMBL; AL359963; CAI15130.1; JOINED; Genomic_DNA.
DR   EMBL; AL358815; CAI15129.1; -; Genomic_DNA.
DR   EMBL; AL359963; CAI15129.1; JOINED; Genomic_DNA.
DR   CCDS; CCDS43859.1; -. [Q9H329-1]
DR   CCDS; CCDS43860.1; -. [Q9H329-2]
DR   RefSeq; NP_060894.2; NM_018424.3. [Q9H329-2]
DR   RefSeq; NP_061987.3; NM_019114.4. [Q9H329-1]
DR   UniGene; Hs.591901; -.
DR   ProteinModelPortal; Q9H329; -.
DR   SMR; Q9H329; 84-367.
DR   BioGrid; 120044; 3.
DR   IntAct; Q9H329; 1.
DR   STRING; 9606.ENSP00000363694; -.
DR   PhosphoSite; Q9H329; -.
DR   DMDM; 209572611; -.
DR   MaxQB; Q9H329; -.
DR   PaxDb; Q9H329; -.
DR   PRIDE; Q9H329; -.
DR   Ensembl; ENST00000374557; ENSP00000363685; ENSG00000095203. [Q9H329-2]
DR   Ensembl; ENST00000374566; ENSP00000363694; ENSG00000095203. [Q9H329-1]
DR   GeneID; 54566; -.
DR   KEGG; hsa:54566; -.
DR   UCSC; uc004bdz.1; human. [Q9H329-1]
DR   UCSC; uc004bea.3; human. [Q9H329-2]
DR   CTD; 54566; -.
DR   GeneCards; GC09M111934; -.
DR   HGNC; HGNC:19818; EPB41L4B.
DR   HPA; HPA042862; -.
DR   MIM; 610340; gene.
DR   neXtProt; NX_Q9H329; -.
DR   PharmGKB; PA134986250; -.
DR   eggNOG; NOG269561; -.
DR   HOGENOM; HOG000231632; -.
DR   HOVERGEN; HBG051434; -.
DR   OMA; TIYTTRK; -.
DR   OrthoDB; EOG73FQM2; -.
DR   PhylomeDB; Q9H329; -.
DR   TreeFam; TF319780; -.
DR   ChiTaRS; EPB41L4B; human.
DR   GenomeRNAi; 54566; -.
DR   NextBio; 57050; -.
DR   PRO; PR:Q9H329; -.
DR   Bgee; Q9H329; -.
DR   CleanEx; HS_EPB41L4B; -.
DR   Genevestigator; Q9H329; -.
DR   GO; GO:0045177; C:apical part of cell; IDA:MGI.
DR   GO; GO:0005737; C:cytoplasm; IEA:UniProtKB-KW.
DR   GO; GO:0005856; C:cytoskeleton; TAS:ProtInc.
DR   GO; GO:0019898; C:extrinsic component of membrane; IEA:InterPro.
DR   GO; GO:0005200; F:structural constituent of cytoskeleton; TAS:ProtInc.
DR   GO; GO:0031032; P:actomyosin structure organization; IDA:MGI.
DR   Gene3D; 1.20.80.10; -; 1.
DR   Gene3D; 2.30.29.30; -; 1.
DR   InterPro; IPR019749; Band_41_domain.
DR   InterPro; IPR019750; Band_41_fam.
DR   InterPro; IPR000798; Ez/rad/moesin_like.
DR   InterPro; IPR014847; FERM-adjacent.
DR   InterPro; IPR014352; FERM/acyl-CoA-bd_prot_3-hlx.
DR   InterPro; IPR019748; FERM_central.
DR   InterPro; IPR019747; FERM_CS.
DR   InterPro; IPR000299; FERM_domain.
DR   InterPro; IPR018979; FERM_N.
DR   InterPro; IPR018980; FERM_PH-like_C.
DR   InterPro; IPR011993; PH_like_dom.
DR   InterPro; IPR029071; Ubiquitin-rel_dom.
DR   Pfam; PF08736; FA; 1.
DR   Pfam; PF09380; FERM_C; 1.
DR   Pfam; PF00373; FERM_M; 1.
DR   Pfam; PF09379; FERM_N; 1.
DR   PRINTS; PR00935; BAND41.
DR   PRINTS; PR00661; ERMFAMILY.
DR   SMART; SM00295; B41; 1.
DR   SUPFAM; SSF47031; SSF47031; 1.
DR   SUPFAM; SSF54236; SSF54236; 1.
DR   PROSITE; PS00661; FERM_2; 1.
DR   PROSITE; PS50057; FERM_3; 1.
PE   2: Evidence at transcript level;
KW   Alternative splicing; Complete proteome; Cytoplasm; Cytoskeleton;
KW   Polymorphism; Reference proteome.
FT   CHAIN         1    900       Band 4.1-like protein 4B.
FT                                /FTId=PRO_0000219404.
FT   DOMAIN       85    369       FERM.
FT   COMPBIAS    504    517       His-rich.
FT   VAR_SEQ     470    518       SYPLPSPVLSSSDRLPFGIEENGGTPFLTAASGRHHHQHQH
FT                                QHQHQHHS -> RPSFQDDRSHWKASASGDDSHFDYVHDQN
FT                                QKNLGGMQSMMYRDKLMTAL (in isoform 2).
FT                                /FTId=VSP_007202.
FT   VAR_SEQ     519    900       Missing (in isoform 2).
FT                                /FTId=VSP_007203.
FT   VARIANT     816    816       N -> T (in dbSNP:rs3750450).
FT                                /FTId=VAR_048356.
FT   CONFLICT     73     73       V -> M (in Ref. 2; BAA96079).
FT   CONFLICT    899    899       E -> R (in Ref. 1; AAG43366).
SQ   SEQUENCE   900 AA;  99712 MW;  9A4BD658DBE65BDE CRC64;
     MLRFLRRTFG RRSMQRYARG AAGRGAAGLG DERDGGPRGG PAAAASSSAL PAAPGGSVFP
     AGGGPLLTGG AAVHISAAGA AKATLYCRVF LLDGTEVSVD LPKHAKGQDL FDQIVYHLDL
     VETDYFGLQF LDSAQVAHWL DHAKPIKKQM KIGPAYALHF RVKYYSSEPN NLREEFTRYL
     FVLQLRHDIL SGKLKCPYET AVELAALCLQ AELGECELPE HTPELVSEFR FIPNQTEAME
     FDIFQRWKEC RGKSPAQAEL SYLNKAKWLE MYGVDMHVVR GRDGCEYSLG LTPTGILIFE
     GANKIGLFFW PKITKMDFKK SKLTLVVVED DDQGREQEHT FVFRLDSART CKHLWKCAVE
     HHAFFRLRTP GNSKSNRSDF IRLGSRFRFS GRTEYQATHG SRLRRTSTFE RKPSKRYPSR
     RHSTFKASNP VIAAQLCSKT NPEVHNYQPQ YHPNIHPSQP RWHPHSPNVS YPLPSPVLSS
     SDRLPFGIEE NGGTPFLTAA SGRHHHQHQH QHQHQHHSNY SLSLTLENKE GPLRSPNSSS
     KSLTKLSPGT PALFSEAAAH LKKLELETVK AAGPWPPLHI NINKAEEKKV SEKTLQTPLL
     PSPVADHVKC NILKAQLENA SRVNIQGGKE ESPFVNINKK SSLQDASVRS PIPIRVETAQ
     PAVEKPEIKP PRVRKLTRQY SFDEDDLPPD LAEAVGVTTS TTTNTTTAAT QVSVPLPSPK
     VQNVSSPHKS EGKGLLSPGA KSPSDRGGAF TLEPGDLLMD FTEATPLAEP ASNPHCAHSR
     CSPPLSLPMK EETTGVCMYP PIKTRLIKTF PVDTMNPFPD TFTTGPQFTA DFRDSKLQCC
     PGPTSPLIPA ATLRPLTETV STVQTIYTTR KPVSLAASAE TLRQELEREK MMKRLLMTEL
//
DBGET integrated database retrieval system