GenomeNet

Database: UniProt
Entry: RYR_DROME
LinkDB: RYR_DROME
Original site: RYR_DROME 
ID   RYR_DROME               Reviewed;        5127 AA.
AC   Q24498; Q24321; Q24499; Q24500; Q24501; Q8MKS3; Q8MKS4; Q8MKS5;
AC   Q9V4Y7;
DT   19-JUL-2003, integrated into UniProtKB/Swiss-Prot.
DT   01-JUN-2003, sequence version 3.
DT   30-AUG-2017, entry version 156.
DE   RecName: Full=Ryanodine receptor;
DE   AltName: Full=Ryanodine receptor 44F;
GN   Name=RyR {ECO:0000312|FlyBase:FBgn0011286};
GN   Synonyms=dry, Rya-r44F {ECO:0000312|FlyBase:FBgn0011286};
GN   ORFNames=CG10844 {ECO:0000312|FlyBase:FBgn0011286};
OS   Drosophila melanogaster (Fruit fly).
OC   Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
OC   Pterygota; Neoptera; Holometabola; Diptera; Brachycera; Muscomorpha;
OC   Ephydroidea; Drosophilidae; Drosophila; Sophophora.
OX   NCBI_TaxID=7227 {ECO:0000312|EMBL:AAF59036.2};
RN   [1] {ECO:0000305}
RP   NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORMS A; B; C AND D), FUNCTION,
RP   TISSUE SPECIFICITY, AND DEVELOPMENTAL STAGE.
RX   PubMed=8276118; DOI=10.1016/0014-5793(94)80634-9;
RA   Takeshima H., Nishi M., Iwabe N., Miyata T., Hosoya T., Masai I.,
RA   Hotta Y.;
RT   "Isolation and characterization of a gene for a ryanodine
RT   receptor/calcium release channel in Drosophila melanogaster.";
RL   FEBS Lett. 337:81-87(1994).
RN   [2]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
RC   STRAIN=Berkeley {ECO:0000269|PubMed:10731132};
RX   PubMed=10731132; DOI=10.1126/science.287.5461.2185;
RA   Adams M.D., Celniker S.E., Holt R.A., Evans C.A., Gocayne J.D.,
RA   Amanatides P.G., Scherer S.E., Li P.W., Hoskins R.A., Galle R.F.,
RA   George R.A., Lewis S.E., Richards S., Ashburner M., Henderson S.N.,
RA   Sutton G.G., Wortman J.R., Yandell M.D., Zhang Q., Chen L.X.,
RA   Brandon R.C., Rogers Y.-H.C., Blazej R.G., Champe M., Pfeiffer B.D.,
RA   Wan K.H., Doyle C., Baxter E.G., Helt G., Nelson C.R., Miklos G.L.G.,
RA   Abril J.F., Agbayani A., An H.-J., Andrews-Pfannkoch C., Baldwin D.,
RA   Ballew R.M., Basu A., Baxendale J., Bayraktaroglu L., Beasley E.M.,
RA   Beeson K.Y., Benos P.V., Berman B.P., Bhandari D., Bolshakov S.,
RA   Borkova D., Botchan M.R., Bouck J., Brokstein P., Brottier P.,
RA   Burtis K.C., Busam D.A., Butler H., Cadieu E., Center A., Chandra I.,
RA   Cherry J.M., Cawley S., Dahlke C., Davenport L.B., Davies P.,
RA   de Pablos B., Delcher A., Deng Z., Mays A.D., Dew I., Dietz S.M.,
RA   Dodson K., Doup L.E., Downes M., Dugan-Rocha S., Dunkov B.C., Dunn P.,
RA   Durbin K.J., Evangelista C.C., Ferraz C., Ferriera S., Fleischmann W.,
RA   Fosler C., Gabrielian A.E., Garg N.S., Gelbart W.M., Glasser K.,
RA   Glodek A., Gong F., Gorrell J.H., Gu Z., Guan P., Harris M.,
RA   Harris N.L., Harvey D.A., Heiman T.J., Hernandez J.R., Houck J.,
RA   Hostin D., Houston K.A., Howland T.J., Wei M.-H., Ibegwam C.,
RA   Jalali M., Kalush F., Karpen G.H., Ke Z., Kennison J.A., Ketchum K.A.,
RA   Kimmel B.E., Kodira C.D., Kraft C.L., Kravitz S., Kulp D., Lai Z.,
RA   Lasko P., Lei Y., Levitsky A.A., Li J.H., Li Z., Liang Y., Lin X.,
RA   Liu X., Mattei B., McIntosh T.C., McLeod M.P., McPherson D.,
RA   Merkulov G., Milshina N.V., Mobarry C., Morris J., Moshrefi A.,
RA   Mount S.M., Moy M., Murphy B., Murphy L., Muzny D.M., Nelson D.L.,
RA   Nelson D.R., Nelson K.A., Nixon K., Nusskern D.R., Pacleb J.M.,
RA   Palazzolo M., Pittman G.S., Pan S., Pollard J., Puri V., Reese M.G.,
RA   Reinert K., Remington K., Saunders R.D.C., Scheeler F., Shen H.,
RA   Shue B.C., Siden-Kiamos I., Simpson M., Skupski M.P., Smith T.J.,
RA   Spier E., Spradling A.C., Stapleton M., Strong R., Sun E.,
RA   Svirskas R., Tector C., Turner R., Venter E., Wang A.H., Wang X.,
RA   Wang Z.-Y., Wassarman D.A., Weinstock G.M., Weissenbach J.,
RA   Williams S.M., Woodage T., Worley K.C., Wu D., Yang S., Yao Q.A.,
RA   Ye J., Yeh R.-F., Zaveri J.S., Zhan M., Zhang G., Zhao Q., Zheng L.,
RA   Zheng X.H., Zhong F.N., Zhong W., Zhou X., Zhu S.C., Zhu X.,
RA   Smith H.O., Gibbs R.A., Myers E.W., Rubin G.M., Venter J.C.;
RT   "The genome sequence of Drosophila melanogaster.";
RL   Science 287:2185-2195(2000).
RN   [3] {ECO:0000305}
RP   GENOME REANNOTATION, AND ALTERNATIVE SPLICING.
RC   STRAIN=Berkeley {ECO:0000269|PubMed:12537572};
RX   PubMed=12537572; DOI=10.1186/gb-2002-3-12-research0083;
RA   Misra S., Crosby M.A., Mungall C.J., Matthews B.B., Campbell K.S.,
RA   Hradecky P., Huang Y., Kaminker J.S., Millburn G.H., Prochnik S.E.,
RA   Smith C.D., Tupy J.L., Whitfield E.J., Bayraktaroglu L., Berman B.P.,
RA   Bettencourt B.R., Celniker S.E., de Grey A.D.N.J., Drysdale R.A.,
RA   Harris N.L., Richter J., Russo S., Schroeder A.J., Shu S.Q.,
RA   Stapleton M., Yamada C., Ashburner M., Gelbart W.M., Rubin G.M.,
RA   Lewis S.E.;
RT   "Annotation of the Drosophila melanogaster euchromatic genome: a
RT   systematic review.";
RL   Genome Biol. 3:RESEARCH0083.1-RESEARCH0083.22(2002).
RN   [4] {ECO:0000305}
RP   NUCLEOTIDE SEQUENCE OF 4619-5127, DEVELOPMENTAL STAGE, AND TISSUE
RP   SPECIFICITY.
RC   TISSUE=Brain {ECO:0000269|PubMed:1338312};
RX   PubMed=1338312;
RA   Hasan G., Rosbash M.;
RT   "Drosophila homologs of two mammalian intracellular Ca(2+)-release
RT   channels: identification and expression patterns of the inositol
RT   1,4,5-triphosphate and the ryanodine receptor genes.";
RL   Development 116:967-975(1992).
RN   [5]
RP   FUNCTION, AND TISSUE SPECIFICITY.
RX   PubMed=10811919; DOI=10.1073/pnas.110145997;
RA   Sullivan K.M.C., Scott K., Zuker C.S., Rubin G.M.;
RT   "The ryanodine receptor is essential for larval development in
RT   Drosophila melanogaster.";
RL   Proc. Natl. Acad. Sci. U.S.A. 97:5942-5947(2000).
RN   [6]
RP   PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1459, AND IDENTIFICATION
RP   BY MASS SPECTROMETRY.
RC   TISSUE=Embryo;
RX   PubMed=18327897; DOI=10.1021/pr700696a;
RA   Zhai B., Villen J., Beausoleil S.A., Mintseris J., Gygi S.P.;
RT   "Phosphoproteome analysis of Drosophila melanogaster embryos.";
RL   J. Proteome Res. 7:1675-1682(2008).
CC   -!- FUNCTION: Intracellular calcium channel that is required for
CC       proper muscle function during embryonic development and may be
CC       essential for excitation-contraction coupling in larval body wall
CC       muscles. {ECO:0000269|PubMed:10811919,
CC       ECO:0000269|PubMed:8276118}.
CC   -!- SUBUNIT: Homotetramer. {ECO:0000250}.
CC   -!- SUBCELLULAR LOCATION: Sarcoplasmic reticulum membrane
CC       {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}. Membrane
CC       {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}. Note=The
CC       number of predicted transmembrane domains varies between
CC       orthologs, but both N-terminus and C-terminus seem to be
CC       cytoplasmic. {ECO:0000250}.
CC   -!- ALTERNATIVE PRODUCTS:
CC       Event=Alternative splicing; Named isoforms=4;
CC       Name=A {ECO:0000269|PubMed:8276118};
CC         IsoId=Q24498-2; Sequence=Displayed;
CC       Name=B {ECO:0000269|PubMed:8276118};
CC         IsoId=Q24498-3; Sequence=VSP_050196;
CC       Name=C {ECO:0000269|PubMed:8276118};
CC         IsoId=Q24498-4; Sequence=VSP_050195;
CC       Name=D {ECO:0000269|PubMed:8276118};
CC         IsoId=Q24498-5; Sequence=VSP_050195, VSP_050196;
CC   -!- TISSUE SPECIFICITY: During embryonic stages 9-10, expression is
CC       seen in mesoderm of all segments in progenitors of the cephalic
CC       and somatic muscles. Adults exhibit high expression in tubular
CC       'jump' muscles of thorax and leg, and lower expression in the
CC       brain, ventral ganglion, head muscles and proboscis muscles.
CC       {ECO:0000269|PubMed:10811919, ECO:0000269|PubMed:1338312,
CC       ECO:0000269|PubMed:8276118}.
CC   -!- DEVELOPMENTAL STAGE: Abundant in 6-12 hours embryos, reduced
CC       expression in second and third instar larval stages and adults.
CC       {ECO:0000269|PubMed:1338312, ECO:0000269|PubMed:8276118}.
CC   -!- DOMAIN: The calcium release channel activity resides in the C-
CC       terminal region while the remaining part of the protein resides in
CC       the cytoplasm. {ECO:0000305}.
CC   -!- MISCELLANEOUS: Channel activity is modulated by the alkaloid
CC       ryanodine that binds to the open Ca-release channel with high
CC       affinity and maintains the channel in an open conformation. The
CC       calcium release channel is modulated by calcium ions, magnesium
CC       ions, ATP and calmodulin (By similarity). {ECO:0000250}.
CC   -!- SIMILARITY: Belongs to the ryanodine receptor (TC 1.A.3.1) family.
CC       {ECO:0000305}.
DR   EMBL; D17389; BAA04212.1; -; Genomic_DNA.
DR   EMBL; D17389; BAA41469.1; -; Genomic_DNA.
DR   EMBL; D17389; BAA41470.1; -; Genomic_DNA.
DR   EMBL; D17389; BAA41471.1; -; Genomic_DNA.
DR   EMBL; AE013599; AAF59036.2; -; Genomic_DNA.
DR   EMBL; AE013599; AAM71082.1; -; Genomic_DNA.
DR   EMBL; AE013599; AAM71083.1; -; Genomic_DNA.
DR   EMBL; AE013599; AAM71084.1; -; Genomic_DNA.
DR   EMBL; Z18536; CAA79221.1; -; mRNA.
DR   PIR; B49131; B49131.
DR   PIR; S40450; S40450.
DR   RefSeq; NP_476991.1; NM_057643.4. [Q24498-2]
DR   RefSeq; NP_476992.1; NM_057644.4. [Q24498-3]
DR   RefSeq; NP_476993.1; NM_057645.3. [Q24498-4]
DR   RefSeq; NP_476994.1; NM_057646.4. [Q24498-5]
DR   UniGene; Dm.22868; -.
DR   ProteinModelPortal; Q24498; -.
DR   SMR; Q24498; -.
DR   BioGrid; 71972; 5.
DR   IntAct; Q24498; 13.
DR   STRING; 7227.FBpp0293114; -.
DR   BindingDB; Q24498; -.
DR   ChEMBL; CHEMBL6045; -.
DR   TCDB; 1.A.3.1.5; the ryanodine-inositol 1,4,5-triphosphate receptor ca(2+) channel (rir-cac) family.
DR   iPTMnet; Q24498; -.
DR   PaxDb; Q24498; -.
DR   PRIDE; Q24498; -.
DR   EnsemblMetazoa; FBtr0088637; FBpp0087718; FBgn0011286. [Q24498-4]
DR   EnsemblMetazoa; FBtr0088638; FBpp0087719; FBgn0011286. [Q24498-3]
DR   EnsemblMetazoa; FBtr0088639; FBpp0087720; FBgn0011286. [Q24498-5]
DR   EnsemblMetazoa; FBtr0088640; FBpp0087721; FBgn0011286. [Q24498-2]
DR   GeneID; 49090; -.
DR   KEGG; dme:Dmel_CG10844; -.
DR   CTD; 49090; -.
DR   FlyBase; FBgn0011286; RyR.
DR   eggNOG; KOG2243; Eukaryota.
DR   eggNOG; ENOG410YCNW; LUCA.
DR   GeneTree; ENSGT00760000119152; -.
DR   InParanoid; Q24498; -.
DR   KO; K04962; -.
DR   OrthoDB; EOG091G00T0; -.
DR   PhylomeDB; Q24498; -.
DR   GenomeRNAi; 49090; -.
DR   PRO; PR:Q24498; -.
DR   Proteomes; UP000000803; Chromosome 2R.
DR   Bgee; FBgn0011286; -.
DR   ExpressionAtlas; Q24498; differential.
DR   Genevisible; Q24498; DM.
DR   GO; GO:0016021; C:integral component of membrane; NAS:UniProtKB.
DR   GO; GO:0005886; C:plasma membrane; IBA:GO_Central.
DR   GO; GO:0033017; C:sarcoplasmic reticulum membrane; IEA:UniProtKB-SubCell.
DR   GO; GO:0005509; F:calcium ion binding; IBA:GO_Central.
DR   GO; GO:0005219; F:ryanodine-sensitive calcium-release channel activity; TAS:UniProtKB.
DR   GO; GO:0006816; P:calcium ion transport; TAS:UniProtKB.
DR   GO; GO:0060047; P:heart contraction; IMP:FlyBase.
DR   GO; GO:0007275; P:multicellular organism development; IEA:UniProtKB-KW.
DR   GO; GO:0006936; P:muscle contraction; IMP:UniProtKB.
DR   GO; GO:0035206; P:regulation of hemocyte proliferation; IMP:FlyBase.
DR   GO; GO:0072347; P:response to anesthetic; IMP:FlyBase.
DR   InterPro; IPR001870; B30.2/SPRY.
DR   InterPro; IPR013320; ConA-like_dom.
DR   InterPro; IPR011992; EF-hand-dom_pair.
DR   InterPro; IPR014821; Ins145_P3_rcpt.
DR   InterPro; IPR005821; Ion_trans_dom.
DR   InterPro; IPR016093; MIR_motif.
DR   InterPro; IPR013662; RIH_assoc-dom.
DR   InterPro; IPR000699; RIH_dom.
DR   InterPro; IPR013333; Ryan_recept.
DR   InterPro; IPR003032; Ryanodine_rcpt.
DR   InterPro; IPR015925; Ryanodine_recept-rel.
DR   InterPro; IPR009460; Ryanrecept_TM4-6.
DR   InterPro; IPR003877; SPRY_dom.
DR   PANTHER; PTHR13715; PTHR13715; 1.
DR   Pfam; PF08709; Ins145_P3_rec; 1.
DR   Pfam; PF00520; Ion_trans; 1.
DR   Pfam; PF02815; MIR; 1.
DR   Pfam; PF08454; RIH_assoc; 1.
DR   Pfam; PF06459; RR_TM4-6; 1.
DR   Pfam; PF01365; RYDR_ITPR; 2.
DR   Pfam; PF02026; RyR; 4.
DR   Pfam; PF00622; SPRY; 3.
DR   PRINTS; PR00795; RYANODINER.
DR   SMART; SM00472; MIR; 4.
DR   SMART; SM00449; SPRY; 3.
DR   SUPFAM; SSF100909; SSF100909; 1.
DR   SUPFAM; SSF47473; SSF47473; 1.
DR   SUPFAM; SSF49899; SSF49899; 2.
DR   SUPFAM; SSF82109; SSF82109; 2.
DR   PROSITE; PS50188; B302_SPRY; 3.
DR   PROSITE; PS50919; MIR; 5.
PE   1: Evidence at protein level;
KW   Alternative splicing; Calcium; Calcium channel; Calcium transport;
KW   Complete proteome; Developmental protein; Ion channel; Ion transport;
KW   Ligand-gated ion channel; Membrane; Phosphoprotein; Receptor;
KW   Reference proteome; Repeat; Sarcoplasmic reticulum; Transmembrane;
KW   Transmembrane helix; Transport.
FT   CHAIN         1   5127       Ryanodine receptor.
FT                                /FTId=PRO_0000219364.
FT   TOPO_DOM      1   4451       Cytoplasmic. {ECO:0000255}.
FT   TRANSMEM   4452   4472       Helical. {ECO:0000255}.
FT   TRANSMEM   4651   4671       Helical. {ECO:0000255}.
FT   TRANSMEM   4683   4703       Helical. {ECO:0000255}.
FT   TRANSMEM   4742   4762       Helical. {ECO:0000255}.
FT   TRANSMEM   4885   4905       Helical. {ECO:0000255}.
FT   TRANSMEM   4924   4944       Helical. {ECO:0000255}.
FT   INTRAMEM   4974   4983       Pore-forming. {ECO:0000250}.
FT   TRANSMEM   4984   5024       Helical. {ECO:0000255}.
FT   TOPO_DOM   5025   5127       Cytoplasmic. {ECO:0000255}.
FT   DOMAIN       94    148       MIR 1. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00131}.
FT   DOMAIN      155    200       MIR 2. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00131}.
FT   DOMAIN      210    264       MIR 3. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00131}.
FT   DOMAIN      270    328       MIR 4. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00131}.
FT   DOMAIN      336    394       MIR 5. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00131}.
FT   DOMAIN      577    803       B30.2/SPRY 1. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00548}.
FT   REPEAT      845    956       1. {ECO:0000250|UniProtKB:Q15413}.
FT   REPEAT      957   1075       2. {ECO:0000250|UniProtKB:Q15413}.
FT   DOMAIN     1032   1217       B30.2/SPRY 2. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00548}.
FT   DOMAIN     1452   1673       B30.2/SPRY 3. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00548}.
FT   REPEAT     2822   2945       3. {ECO:0000250|UniProtKB:Q15413}.
FT   REPEAT     2946   3063       4. {ECO:0000250|UniProtKB:Q15413}.
FT   REGION      845   3063       4 X approximate repeats.
FT   COMPBIAS   4686   4711       Gly-rich.
FT   SITE       4162   4162       Important for activation by Ca(2+).
FT                                {ECO:0000250}.
FT   MOD_RES    1459   1459       Phosphoserine.
FT                                {ECO:0000269|PubMed:18327897}.
FT   VAR_SEQ    1135   1165       VTKMHAGSIEHFGVRYEAGDVIGCFIDVKEQ -> EEKVYG
FT                                GVSESFGKQCGPGDIVGVFLDLADH (in isoform C
FT                                and isoform D).
FT                                {ECO:0000303|PubMed:8276118}.
FT                                /FTId=VSP_050195.
FT   VAR_SEQ    1876   1889       Missing (in isoform B and isoform D).
FT                                {ECO:0000303|PubMed:8276118}.
FT                                /FTId=VSP_050196.
FT   CONFLICT    314    316       CLR -> SW (in Ref. 1; BAA41469/BAA41470/
FT                                BAA41471/BAA04212). {ECO:0000305}.
FT   CONFLICT   1045   1079       VRTLLVYGYVLDPPTGEGTEALLAEAQRLKFAGFR -> SA
FT                                NAPGLRICLGSSDGRRNGGTSGRGTTPQVRRIP (in
FT                                Ref. 1; BAA41469/BAA41470/BAA41471/
FT                                BAA04212). {ECO:0000305}.
FT   CONFLICT   2282   2282       L -> I (in Ref. 1; BAA41469/BAA41470/
FT                                BAA41471/BAA04212). {ECO:0000305}.
FT   CONFLICT   2550   2550       I -> S (in Ref. 1; BAA41469/BAA41470/
FT                                BAA41471/BAA04212). {ECO:0000305}.
FT   CONFLICT   2927   2927       A -> P (in Ref. 1; BAA41469/BAA41470/
FT                                BAA41471/BAA04212). {ECO:0000305}.
FT   CONFLICT   3214   3214       L -> Q (in Ref. 1; BAA41469/BAA41470/
FT                                BAA41471/BAA04212). {ECO:0000305}.
FT   CONFLICT   3361   3361       A -> G (in Ref. 1; BAA41469/BAA41470/
FT                                BAA41471/BAA04212). {ECO:0000305}.
FT   CONFLICT   4096   4096       T -> I (in Ref. 1; BAA41469/BAA41470/
FT                                BAA41471/BAA04212). {ECO:0000305}.
FT   CONFLICT   4633   4633       Y -> D (in Ref. 4). {ECO:0000305}.
FT   CONFLICT   4695   4695       I -> T (in Ref. 4). {ECO:0000305}.
FT   CONFLICT   5022   5024       DAF -> AL (in Ref. 4). {ECO:0000305}.
FT   CONFLICT   5073   5073       M -> I (in Ref. 4). {ECO:0000305}.
FT   CONFLICT   5077   5077       M -> L (in Ref. 4). {ECO:0000305}.
FT   CONFLICT   5103   5127       WDFFPVGDCFRKQYEDELSGGGGGG -> GTSSQWETASAS
FT                                NTRMSFPAEAAAA (in Ref. 4). {ECO:0000305}.
SQ   SEQUENCE   5127 AA;  581012 MW;  01B637D778DECE6A CRC64;
     MAEAEGGSEQ DDVSFLRTED MVTLSCTATG ERVCLAAEGF GNRHCFLENI ADKNVPPDLS
     QCVFVIEQAL SVRALQELVT AAGSETGKGT GSGHRTLLYG NAILLRHHNS DMYLACLSTS
     SSNDKLSFDV GLQEHSQGEA CWWTVHPASK QRSEGEKVRV GDDLILVSVA TERYLHTTKE
     NEQSIVNASF HVTHWSVQPY GTGISRMKYV GYVFGGDVLR FFHGGDECLT IPSTWGREAG
     QNIVIYEGGV VMAQARSLWR LELARTKWTG GFINWYHPMR IRHITTGRYL GVNDSNELIL
     VKKEEASIAT TTFCLRQEKD DEKKVLEDKD LEVIGSPIIK YGDTTVIVQH CETSLWLSYK
     SYETKKKGVG KVEEKQAILH EEGKMDDCLD FSRSQEEESK TARVIRKCSS LFTQFITALE
     TLQSNRRHSI FFQKVNLNEM VMCLEDLINY FSQPEDDMEH EEKQNRFRAL RNRQDLFQEE
     GVLNLILEAI DKINIITSQG FLASFLAGDE TGQSWDLIST YLYQLLAAII KGNHTNCAQF
     ANSNRLNWLF SRLGSQASSE GSGMLDVLHC VLIDSPEALN MMRDEHIKVI ISLLEKHGRD
     PKVLDVLCSL CVGNGVAVRS SQNNICDFLL PGKNLLLQTL LVDHVASIRP NIFVGRVDGS
     SMYQKWYFEV TMDHIEQTTH MMPHLRIGWA NTSGYVPYPG GGKKWGGNGV GDDLYSFGFD
     GAFLWTGGRK TLVVDALPEE PFIRKGDVIG VAIDLSVPII TFTFNGVKVR GSFRDFNLDG
     MFFPVMSCSS KLSCRFLFGG DHGRLKFAPP MGFSALVQCL MPQQILSLDP CFYFGNLAKN
     VLAGPWLIED DTAFVPKPVD TTGVTLPSSV DQIKEKLAEN IHEMWALNKI EAGWSWGEHR
     DDYHRIHPCL THFEKLPAAE KRYDNQLAVQ TLKTIISLGY YITMDKPPAR IRPVRLPNEI
     FMQGNGYKPA PLDLSAVTLT PKLEELVDQL AENTHNLWAR ERIQQGWTYG LNEDSENHRS
     PHLVPYAKVD EAIKKANRDT ASETVRTLLV YGYVLDPPTG EGTEALLAEA QRLKFAGFRT
     YRVERNYAVT SGKWYFEFEV LTSGPMRVGW ARADCYPGAM LGSEDTSWAF DGHNVTKMHA
     GSIEHFGVRY EAGDVIGCFI DVKEQTISFS LNGELLMDAL GGETTFADVT AEGVGFVPAC
     TLGVGQKARL IYGQDVDSLK FFTTCGLQEG YEPFCVNMRR PVTHWYTKDQ PIFENTEEMP
     DCRIDVTRIP GGADTPPHLK ISHNTFETME KANWEFLRLS LPVTCMGEFI SEQEKARRWD
     EIKNRQYRLM REAEIAAQMQ VQTQAAHMDH MLKGGFNMND IKGLTRNFDE HADAEADHMM
     RGPNRPPRKG SLTRNITFET DMSAALDEMQ RSTSVLDMNG LGEEMDDKKK RGRSPFKFFS
     KKSRDQSREK MGARTLDTSL ERRNTVAHGR NVVNQQMTTR APTLRLNNAE IPPSPVPQGP
     KQLSGSNLGQ QPVETSGDEM FDAECLKLIN EYFYGVRIFP GQDPTHVYVG WVTTQYHLHS
     REFNKNKVRR GSVYIEDDYE MAIERIDRQS CYVVRADELF NEVTQDASGK GASQGMFVGC
     FVDTATGIIR FTCEGKDTSH RWMMEPDTKL FPAIFVEATS KEILQIELGR TPTTLPLSAA
     VLPTSDKHIN PQSPPRLKVQ CLRPHQWARV PNTALQVHAL KLSDVRGWSM LCEDPVSMLA
     LHIPEEDRCI DILELIEMDK LLSFHAHSLT LYAALCYQSN YRAAHALCQH VDQKQLLYAI
     RSEYMSGPLR QGFYDLLIAL HLESHATTME VCKNEYITPL GAELKELYSD EEMQHSLRSL
     VTESVRPQLR MTEITPPVIA TSSMPSVSSE PIPDIDQLYS PKFPLEVVRQ FVMEALKDAV
     EINQVHNRDP IGWTNENLFL PLIKLTDRLL LVGVLTDEDV QRLLVMIDPE TWDQAFEREG
     KDEHRKGLLT MKMAEGAKLQ MCYLLHHLYD TQLRHRVESI IAFSHDFVGD LQTDQLRRYI
     EIKQSDLPSA VAAKKTKEFR CPPREQMNQI LCFKNLEPDD QDNCTCGLEL RGRLGDFHDS
     LMQKVSLNAL QEPDGVEGTA IEEVKTGPIT KIYNFINTVK ELEEGPKEVE EPEKKTPEEV
     FRKVLIKTIV SWAEESQIEN PKLVREMFSL LLRQYDTVGE LVRALEKTYV INTRARDDVA
     EMWVGLSQIR ALLPVQMSQE EEELMRKRLW KLVNNATFFQ HPDLIRILRV HENVMAVMMN
     TLGRRAQAQS DAPTQSEVAE GAPSKEKDTS HEMVVACCRF LCYFCRTGRQ NQKAMFDHFD
     FLLDNANILL ARPSLRGSTP LDVAYSSLME NTELALALRE HYLEKIAVYL SRCGLQSNSE
     LVEKGYPDLG WDPVEGERYL DFLRYCVWVN GESVEENANL VIRLLIRRPE CLGPALRGEG
     EGLFRAIVEA NRMSERISDR CKMQDEAEGT IAGLNFTHPL PEGEEDEDYI DTGAAILNFY
     CTLVDLLGRC APDASVIEQG KNESLRARAI LRSLVPLEDL QGVLSLKFTL SQTAPGEEKP
     KSDMPSGLLP NNKQSIVLFL ERVYGIEAQD LFYRLLEDAF LPDLRTATIL DKSDGSESDM
     ALAMNRYIGN SILPLLIKHS KFYNEAENYA SLLDATLHTV YRLSKNRMLT KGQREAVSDF
     LVALTSQMQP AMLLKLLRKL TVDVSKLSEY TTVALRLLTL HFDRCAKYYG STQGQGSYGA
     SSDEEKRLTM LLFSNIFDSL SNMDYDPELF GKALPCLIAI GCALPPDYSL SKNTDEDYYG
     RQMGAPDQPQ YMPNPIDTNN VHLDNDLNSL VQKFSEHYHD AWASRRLEGG WTYGDIRSDN
     DRKHPRLKPY NMLSEYERER YRDPVRECLK GLLAIGWTVE HSEVEVALNH RGSTRRQSKP
     QINEFQNEGS PFNYNPHPVD MSNLTLSREM QNMAERLAEN SHDIWAKKKN EELNGCGGVI
     HPQLVPYDLL TDKEKKKDRE RSQEFLKYMQ YQGYKLHKPS KGGAVEEGGA TQAAVELRFS
     YSLLEKLIQY LDRATINMKL LKPSTTFSRR SSFKTATRDI KFFSKVVLPL MEKYFSTHRN
     YFIAIATATN NIGAASLKEK EMVASIFCKL AALLRNRLSA FGPDVRITVR CLQVLVKGID
     ARTLTKNCPE FIRTSMLTFF NQTSDDLGNT ILNLQDGKYS HLRGTHLKTS TSLGYVNQVV
     LPVLTAMFDH LAACDYGSDL LLDEIQVASY KILAALYHLG TDGTLTHDRK YLKTEIERHR
     PALGSCLGAY SSCFPVAFLE PHLNKHNQYS LLNRIADHSL EAQDIMVKME SCMPNLETIL
     AEVDQFVESD KTYNDAPHII DVILPLLCAY LPFWWSQGPD NVSPTSGNHV TMVTADHMNP
     LLRNVLKMIK KNIGNDNAPW MTRIAAYTQQ IIINTSEELL KDPFLPLAER VKKRTENMLH
     KEDSMRGFIK SATDDTSQVE TQLQEDWNLL VRDIYSFYPL LIKYVDLQRN HWLKDNIPEA
     EELYNHVAEI FNIWSKSQYF LKEEQNFISA NEIDNMALIM PTATRRSAIS EGAPAVGGKV
     KKKKKNRDKK RDKDKEVQAS LMVACLKRLL PVGLNLFAGR EQELVQHCKD RYLKKMPEYD
     VIEFARNQLT LPDKLDPSDE MSWQHYLYSK LGKTEEPVDE QALEKANVNS NEKGKDKTQE
     TVDRIVAMAK VLFGLHMIDH PQQQSKNVYR SVVSIQRKRA VIACFRQTSL HSLPRHRACN
     IFARSYYEQW LQEENVGQEV MVEDLTQTFE DSEKSKKEGE ETDSKPDPLT QLVTTFCRGA
     MTERSGALQE DLLYMSYAQI AAKSTGKEEE EGGDEEGGEG GEEGEGTSIH EQEMEKQKLL
     FHQARLSNRG VAEMVLLHIS ASKGIPSEMV MTTLNLGIAI LRGGNIDIQM GMLNHLKEKK
     DVGFFTSIAG LMNSCSVLDL DAFERNTKAE GLGVGSEGAA GEKNMHDAEF TCALFRFIQL
     TCEGHNLEWQ NYLRTQAGNT TTVNVVICTV DYLLRLQESI MDFYWHYSSK EIIDPAGKAN
     FFKAIEVASQ VFNTLTEVIQ GPCTLNQQAL AHSRLWDAVG GFLFLFSHMQ DKLSKHSSQV
     DLLKELLNLQ KDMITMMLSM LEGNVVNGTI GKQMVDTLVE SASNVELILK YFDMFLKLAD
     LIESPSFHEV DMKNEGWVTP KDFREKMEQS KNYTPEEMDF LLACCERNHE GKIDYRAFVE
     HFHEPSKEIG FNLAVLLTNL SEHMPNEPRL ARFLETAGSV LNYFEPFLGR IEILGSSKRI
     ERVYFEIKDS NIEQWEKPQI RESKRAFFYS IVTEGGDKEK LEAFVNFCED AIFEMTHASG
     LMATDDGGGN VKRDTAYSSY MSEEEEERAA RDPIRRTITA VKEGLKFGVH MLSPANIKHQ
     IGVMQTKSIP ELIVGFFKII FYIFYYTGYA HFCVVRYIFG ILLNLMRGPA PEQEEEPVVE
     EETFGRALPP LPLEEPPGTV QAFGLDINKE ENGMYKVVVH ESPANSSMEE GGESSPEDGA
     AASGELVEGE PHQEPISIVD LLGGEAAKKA AQERQEAQKA QEAAMASIEA EAKKSSSAPQ
     ETPAVHQIDF SQYTHRAVSF LARNFYNLKY VALVLAFSIN FMLLFYKVTS FTEEADSSAE
     EELILGSGSG GGADITGSGF GGSGDGGSGD GEMEDEIPEL VHVDEDFFYM EHVLRIAACL
     HSLVSLAMLI AYYHLKVPLA IFKREKEIAR RLEFEGLFIA EQPEDDDFKS HWDKLVISAK
     SFPVNYWDKF VKKKVRQKYS ETYDFDSISN LLGMEKSTFA AQESEETGIF KYIMNIDWRY
     QVWKAGVTFT DNAFLYSLWY FSFSVMGNFN NFFFAAHLLD VAVGFKTLRT ILQSVTHNGK
     QLVLTVMLLT IIVYIYTVIA FNFFRKFYIQ EEDEEVDKKC HDMLTCFVFH LYKGVRAGGG
     IGDEIGDPDG DDYEVYRIIF DITFFFFVII ILLAIIQGLI IDAFGELRDQ LESVKDNMES
     NCFICGMGKD FFDIVPHGFD THVQKEHNLA NYMFFLMHLI NKPDTEYTGQ ETYVWNMYQQ
     RSWDFFPVGD CFRKQYEDEL SGGGGGG
//
DBGET integrated database retrieval system