GenomeNet

Database: UniProt
Entry: TMM8B_HUMAN
LinkDB: TMM8B_HUMAN
Original site: TMM8B_HUMAN 
ID   TMM8B_HUMAN             Reviewed;         472 AA.
AC   A6NDV4; B3KQF3; O75539; Q49AB1; Q4KMX5; Q5TCW5; Q9HBY2; Q9P0U7;
DT   20-MAY-2008, integrated into UniProtKB/Swiss-Prot.
DT   15-JAN-2008, sequence version 2.
DT   09-JUL-2014, entry version 63.
DE   RecName: Full=Transmembrane protein 8B;
DE   AltName: Full=Nasopharyngeal carcinoma-associated gene 6 protein;
DE   AltName: Full=Protein NAG-5;
DE   AltName: Full=Protein NGX6;
GN   Name=TMEM8B; Synonyms=C9orf127, NGX6;
OS   Homo sapiens (Human).
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
OC   Catarrhini; Hominidae; Homo.
OX   NCBI_TaxID=9606;
RN   [1]
RP   NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
RX   PubMed=11565907; DOI=10.1023/A:1010912311564;
RA   Li J., Tan C., Xiang Q., Zhang X., Ma J., Wang J.-R., Yang J.,
RA   Li W.-F., Shen S.-R., Liang S., Li G.-Y.;
RT   "Proteomic detection of changes in protein synthesis induced by NGX6
RT   transfected in human nasopharyngeal carcinoma cells.";
RL   J. Protein Chem. 20:265-271(2001).
RN   [2]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
RC   TISSUE=Brain;
RA   Yu W., Gibbs R.A.;
RL   Submitted (JUN-1998) to the EMBL/GenBank/DDBJ databases.
RN   [3]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
RX   PubMed=14702039; DOI=10.1038/ng1285;
RA   Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
RA   Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
RA   Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
RA   Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
RA   Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A.,
RA   Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M.,
RA   Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y.,
RA   Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M.,
RA   Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K.,
RA   Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S.,
RA   Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J.,
RA   Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y.,
RA   Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N.,
RA   Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
RA   Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
RA   Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
RA   Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
RA   Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
RA   Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y.,
RA   Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T.,
RA   Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y.,
RA   Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S.,
RA   Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T.,
RA   Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M.,
RA   Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T.,
RA   Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K.,
RA   Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R.,
RA   Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.;
RT   "Complete sequencing and characterization of 21,243 full-length human
RT   cDNAs.";
RL   Nat. Genet. 36:40-45(2004).
RN   [4]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
RX   PubMed=15164053; DOI=10.1038/nature02465;
RA   Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E.,
RA   Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C.,
RA   Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S.,
RA   Babbage A.K., Babbage S., Bagguley C.L., Bailey J., Banerjee R.,
RA   Barker D.J., Barlow K.F., Bates K., Beasley H., Beasley O., Bird C.P.,
RA   Bray-Allen S., Brown A.J., Brown J.Y., Burford D., Burrill W.,
RA   Burton J., Carder C., Carter N.P., Chapman J.C., Chen Y., Clarke G.,
RA   Clark S.Y., Clee C.M., Clegg S., Collier R.E., Corby N., Crosier M.,
RA   Cummings A.T., Davies J., Dhami P., Dunn M., Dutta I., Dyer L.W.,
RA   Earthrowl M.E., Faulkner L., Fleming C.J., Frankish A.,
RA   Frankland J.A., French L., Fricker D.G., Garner P., Garnett J.,
RA   Ghori J., Gilbert J.G.R., Glison C., Grafham D.V., Gribble S.,
RA   Griffiths C., Griffiths-Jones S., Grocock R., Guy J., Hall R.E.,
RA   Hammond S., Harley J.L., Harrison E.S.I., Hart E.A., Heath P.D.,
RA   Henderson C.D., Hopkins B.L., Howard P.J., Howden P.J., Huckle E.,
RA   Johnson C., Johnson D., Joy A.A., Kay M., Keenan S., Kershaw J.K.,
RA   Kimberley A.M., King A., Knights A., Laird G.K., Langford C.,
RA   Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C., Lloyd D.M.,
RA   Lovell J., Martin S., Mashreghi-Mohammadi M., Matthews L., McLaren S.,
RA   McLay K.E., McMurray A., Milne S., Nickerson T., Nisbett J.,
RA   Nordsiek G., Pearce A.V., Peck A.I., Porter K.M., Pandian R.,
RA   Pelan S., Phillimore B., Povey S., Ramsey Y., Rand V., Scharfe M.,
RA   Sehra H.K., Shownkeen R., Sims S.K., Skuce C.D., Smith M.,
RA   Steward C.A., Swarbreck D., Sycamore N., Tester J., Thorpe A.,
RA   Tracey A., Tromans A., Thomas D.W., Wall M., Wallis J.M., West A.P.,
RA   Whitehead S.L., Willey D.L., Williams S.A., Wilming L., Wray P.W.,
RA   Young L., Ashurst J.L., Coulson A., Blocker H., Durbin R.M.,
RA   Sulston J.E., Hubbard T., Jackson M.J., Bentley D.R., Beck S.,
RA   Rogers J., Dunham I.;
RT   "DNA sequence and analysis of human chromosome 9.";
RL   Nature 429:369-374(2004).
RN   [5]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
RA   Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L.,
RA   Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R.,
RA   Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V.,
RA   Hannenhalli S., Turner R., Yooseph S., Lu F., Nusskern D.R.,
RA   Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H.,
RA   Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G.,
RA   Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W.,
RA   Venter J.C.;
RL   Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases.
RN   [6]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).
RC   TISSUE=Brain;
RX   PubMed=15489334; DOI=10.1101/gr.2596504;
RG   The MGC Project Team;
RT   "The status, quality, and expansion of the NIH full-length cDNA
RT   project: the Mammalian Gene Collection (MGC).";
RL   Genome Res. 14:2121-2127(2004).
RN   [7]
RP   FUNCTION, INTERACTION WITH EZR, SUBCELLULAR LOCATION, GLYCOSYLATION,
RP   AND INDUCTION.
RX   PubMed=15498789; DOI=10.1093/carcin/bgh312;
RA   Ma J., Zhou J., Fan S., Wang L.-L., Li X.-L., Yan Q., Zhou M.,
RA   Liu H.-Y., Zhang Q., Zhou H., Gan K., Li Z., Peng C., Xiong W.,
RA   Tan C., Shen S.-R., Yang J., Li J., Li G.-Y.;
RT   "Role of a novel EGF-like domain-containing gene NGX6 in cell adhesion
RT   modulation in nasopharyngeal carcinoma cells.";
RL   Carcinogenesis 26:281-291(2005).
RN   [8]
RP   FUNCTION.
RX   PubMed=15723283; DOI=10.1002/jcb.20393;
RA   Wang L.-L., Ma J., Li J., Li X.-L., Zhang Q., Peng S.-P., Peng C.,
RA   Zhou M., Xiong W., Yang J., Zhou J., Fan S., Tan C., Yan Q.,
RA   Shen S.-R., Li G.-Y.;
RT   "NGX6 gene inhibits cell proliferation and plays a negative role in
RT   EGFR pathway in nasopharyngeal carcinoma cells.";
RL   J. Cell. Biochem. 95:64-73(2005).
RN   [9]
RP   FUNCTION, AND SUBCELLULAR LOCATION.
RX   PubMed=17641538; DOI=10.1159/000106073;
RA   Peng S.P., Li X.-L., Wang L., Ou-Yang J., Ma J., Wang L.-L.,
RA   Liu H.-Y., Zhou M., Tang Y.-L., Li W.-S., Luo X.-M., Cao L., Tang K.,
RA   Shen S.-R., Li G.-Y.;
RT   "The role of NGX6 and its deletion mutants in the proliferation,
RT   adhesion and migration of nasopharyngeal carcinoma 5-8F cells.";
RL   Oncology 71:273-281(2006).
RN   [10]
RP   FUNCTION, AND INTERACTION WITH EZR.
RX   PubMed=17270023; DOI=10.1111/j.1349-7006.2007.00410.x;
RA   Peng S.-P., Fan S., Li X.-L., Wang L., Liu H.-Y., Zhou M., Wang L.-L.,
RA   Shen S.-R., Li G.-Y.;
RT   "The expression of ezrin in NPC and its interaction with NGX6, a novel
RT   candidate suppressor.";
RL   Cancer Sci. 98:341-349(2007).
CC   -!- FUNCTION: May function as a regulator of the EGFR pathway.
CC       Probable tumor suppressor which may function in cell growth,
CC       proliferation and adhesion.
CC   -!- SUBUNIT: Isoform 2 (via its cytoplasmic part) interacts with EZR.
CC   -!- SUBCELLULAR LOCATION: Isoform 2: Cell membrane; Multi-pass
CC       membrane protein (Probable). Cytoplasm (Probable). Nucleus
CC       (Probable). Mitochondrion. Endoplasmic reticulum. Note=Also
CC       detected in mitochondrion and endoplasmic reticulum.
CC   -!- ALTERNATIVE PRODUCTS:
CC       Event=Alternative splicing; Named isoforms=3;
CC       Name=1;
CC         IsoId=A6NDV4-1; Sequence=Displayed;
CC       Name=2;
CC         IsoId=A6NDV4-2; Sequence=VSP_033452, VSP_033453;
CC       Name=3;
CC         IsoId=A6NDV4-3; Sequence=VSP_033450, VSP_033451, VSP_033452,
CC                                  VSP_033453;
CC         Note=No experimental confirmation available;
CC   -!- INDUCTION: Isoform 2 is down-regulated in nasopharyngeal carcinoma
CC       cells.
CC   -!- PTM: Isoform 2 is N-glycosylated.
CC   -!- SIMILARITY: Belongs to the TMEM8 family.
CC   -!- SIMILARITY: Contains 1 EGF-like domain.
CC   -!- SEQUENCE CAUTION:
CC       Sequence=AAC28644.1; Type=Erroneous initiation;
CC       Sequence=AAF34820.1; Type=Erroneous initiation; Note=Translation N-terminally shortened;
CC       Sequence=AAF34820.1; Type=Miscellaneous discrepancy; Note=Contaminating sequence. Sequence of unknown origin in the N-terminal part;
CC   -----------------------------------------------------------------------
CC   Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms
CC   Distributed under the Creative Commons Attribution-NoDerivs License
CC   -----------------------------------------------------------------------
DR   EMBL; AF149297; AAF34820.1; ALT_SEQ; mRNA.
DR   EMBL; AF188239; AAG29055.1; -; mRNA.
DR   EMBL; AF070572; AAC28644.1; ALT_INIT; mRNA.
DR   EMBL; AK074844; BAG52015.1; -; mRNA.
DR   EMBL; AL133410; CAI10995.1; -; Genomic_DNA.
DR   EMBL; AL133410; CAI10996.2; -; Genomic_DNA.
DR   EMBL; CH471071; EAW58325.1; -; Genomic_DNA.
DR   EMBL; BC041377; -; NOT_ANNOTATED_CDS; mRNA.
DR   EMBL; BC098265; AAH98265.1; -; mRNA.
DR   EMBL; BC098296; AAH98296.1; -; mRNA.
DR   EMBL; BC099733; AAH99733.1; -; mRNA.
DR   CCDS; CCDS43800.1; -. [A6NDV4-1]
DR   CCDS; CCDS6595.1; -. [A6NDV4-2]
DR   RefSeq; NP_001036054.1; NM_001042589.2. [A6NDV4-1]
DR   RefSeq; NP_001036055.1; NM_001042590.2. [A6NDV4-1]
DR   RefSeq; NP_057530.2; NM_016446.3. [A6NDV4-2]
DR   UniGene; Hs.493808; -.
DR   ProteinModelPortal; A6NDV4; -.
DR   BioGrid; 119714; 1.
DR   MINT; MINT-2873602; -.
DR   PaxDb; A6NDV4; -.
DR   PRIDE; A6NDV4; -.
DR   Ensembl; ENST00000377988; ENSP00000367227; ENSG00000137103. [A6NDV4-1]
DR   Ensembl; ENST00000377991; ENSP00000367230; ENSG00000137103. [A6NDV4-1]
DR   Ensembl; ENST00000377996; ENSP00000367235; ENSG00000137103. [A6NDV4-2]
DR   Ensembl; ENST00000439587; ENSP00000395810; ENSG00000137103. [A6NDV4-2]
DR   GeneID; 51754; -.
DR   KEGG; hsa:51754; -.
DR   UCSC; uc003zyk.3; human. [A6NDV4-2]
DR   UCSC; uc003zym.4; human. [A6NDV4-1]
DR   CTD; 51754; -.
DR   GeneCards; GC09P035814; -.
DR   HGNC; HGNC:21427; TMEM8B.
DR   HPA; HPA052130; -.
DR   neXtProt; NX_A6NDV4; -.
DR   PharmGKB; PA165586305; -.
DR   eggNOG; NOG77604; -.
DR   OMA; TIAIRSH; -.
DR   OrthoDB; EOG7FNC6S; -.
DR   PhylomeDB; A6NDV4; -.
DR   TreeFam; TF331003; -.
DR   ChiTaRS; TMEM8B; human.
DR   GeneWiki; C9orf127; -.
DR   GenomeRNAi; 51754; -.
DR   NextBio; 55850; -.
DR   PRO; PR:A6NDV4; -.
DR   Bgee; A6NDV4; -.
DR   CleanEx; HS_C9orf127; -.
DR   Genevestigator; A6NDV4; -.
DR   GO; GO:0009986; C:cell surface; IDA:HGNC.
DR   GO; GO:0005783; C:endoplasmic reticulum; IEA:UniProtKB-SubCell.
DR   GO; GO:0016021; C:integral component of membrane; IEA:UniProtKB-KW.
DR   GO; GO:0005739; C:mitochondrion; IEA:UniProtKB-SubCell.
DR   GO; GO:0005634; C:nucleus; IEA:UniProtKB-SubCell.
DR   GO; GO:0005886; C:plasma membrane; IDA:HGNC.
DR   GO; GO:0005515; F:protein binding; IPI:HGNC.
DR   GO; GO:0007160; P:cell-matrix adhesion; IMP:HGNC.
DR   GO; GO:0040008; P:regulation of growth; IEA:UniProtKB-KW.
DR   GO; GO:0007346; P:regulation of mitotic cell cycle; TAS:HGNC.
DR   InterPro; IPR021910; DUF3522.
DR   InterPro; IPR000742; EG-like_dom.
DR   InterPro; IPR013032; EGF-like_CS.
DR   Pfam; PF12036; DUF3522; 1.
DR   SMART; SM00181; EGF; 1.
DR   PROSITE; PS00022; EGF_1; 1.
DR   PROSITE; PS01186; EGF_2; 1.
PE   1: Evidence at protein level;
KW   Alternative splicing; Cell adhesion; Cell membrane; Complete proteome;
KW   Cytoplasm; Disulfide bond; EGF-like domain; Endoplasmic reticulum;
KW   Glycoprotein; Growth regulation; Membrane; Mitochondrion; Nucleus;
KW   Reference proteome; Transmembrane; Transmembrane helix.
FT   CHAIN         1    472       Transmembrane protein 8B.
FT                                /FTId=PRO_0000333039.
FT   TOPO_DOM      1    233       Extracellular (Potential).
FT   TRANSMEM    234    254       Helical; (Potential).
FT   TOPO_DOM    255    257       Cytoplasmic (Potential).
FT   TRANSMEM    258    277       Helical; (Potential).
FT   TOPO_DOM    278    292       Extracellular (Potential).
FT   TRANSMEM    293    313       Helical; (Potential).
FT   TOPO_DOM    314    315       Cytoplasmic (Potential).
FT   TRANSMEM    316    336       Helical; (Potential).
FT   TOPO_DOM    337    342       Extracellular (Potential).
FT   TRANSMEM    343    363       Helical; (Potential).
FT   TOPO_DOM    364    379       Cytoplasmic (Potential).
FT   TRANSMEM    380    400       Helical; (Potential).
FT   TOPO_DOM    401    405       Extracellular (Potential).
FT   TRANSMEM    406    426       Helical; (Potential).
FT   TOPO_DOM    427    472       Cytoplasmic (Potential).
FT   DOMAIN      182    221       EGF-like.
FT   CARBOHYD     92     92       N-linked (GlcNAc...) (Potential).
FT   CARBOHYD    100    100       N-linked (GlcNAc...) (Potential).
FT   DISULFID    186    196       By similarity.
FT   DISULFID    190    209       By similarity.
FT   DISULFID    211    220       By similarity.
FT   VAR_SEQ       1     81       Missing (in isoform 3).
FT                                /FTId=VSP_033450.
FT   VAR_SEQ      82     93       GGVLSLELQLNA -> MWRPHFHTCPPQ (in isoform
FT                                3).
FT                                /FTId=VSP_033451.
FT   VAR_SEQ     274    337       FYHACDQPGIVVFCIMDYDVLQFCDFLGSLMSVWVTVIAMA
FT                                RLQPVVKQVLYLLGAMLLSMALQ -> VCGGVCILSLGACA
FT                                WWWVTVCISTTFSEGLGMSVPSLCLLQTETAVLPKLSCIDN
FT                                GHFCKTHWSK (in isoform 2 and isoform 3).
FT                                /FTId=VSP_033452.
FT   VAR_SEQ     338    472       Missing (in isoform 2 and isoform 3).
FT                                /FTId=VSP_033453.
FT   CONFLICT    178    178       R -> W (in Ref. 6; AAH98296).
SQ   SEQUENCE   472 AA;  51941 MW;  3E5EA4495CF54389 CRC64;
     MNMPQSLGNQ PLPPEPPSLG TPAEGPGTTS PPEHCWPVRP TLRNELDTFS VHFYIFFGPS
     VALPPERPAV FAMRLLPVLD SGGVLSLELQ LNASSVRQEN VTVFGCLTHE VPLSLGDAAV
     TCSKESLAGF LLSVSATTRV ARLRIPFPQT GTWFLALRSL CGVGPRFVRC RNATAEVRMR
     TFLSPCVDDC GPYGQCKLLR THNYLYAACE CKAGWRGWGC TDSADALTYG FQLLSTLLLC
     LSNLMFLPPV VLAIRSRYVL EAAVYTFTMF FSTFYHACDQ PGIVVFCIMD YDVLQFCDFL
     GSLMSVWVTV IAMARLQPVV KQVLYLLGAM LLSMALQLDR HGLWNLLGPS LFALGILATA
     WTVRSVRRRH CYPPTWRRWL FYLCPGSLIA GSAVLLYAFV ETRDNYFYIH SIWHMLIAGS
     VGFLLPPRAK TDHGVPSGAR ARGCGYQLCI NEQEELGLVG PGGATVSSIC AS
//
DBGET integrated database retrieval system