KEGG   Ureaplasma parvum serovar 3 ATCC 27815: UPA3_0089Help
Entry
UPA3_0089         CDS       T00680                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
upa  Ureaplasma parvum serovar 3 ATCC 27815
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:upa03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
107897..108502
Genome map
AA seq 201 aa AA seqDB search
MSKPVEFEMLVDALKSLPGVGTKNANKWAFFLLQQDQKYIDDLIKRIKEAKTNILKCKYC
ANFTNKDECDICLNEYRDFTKLMIVTTNEDLERIESANIYNGLYHITNGEISLRKNVVIE
HTNIKTIKERVLNGSFKEIIIATSYTHDGEVTADYIIRMLEDIKDLQIYRIGFGIPLNSS
IDYADDETLKQSLINKRKIRN
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaccagtagaatttgaaatgcttgttgatgcacttaaatcattacctggtgta
ggaacaaaaaatgctaataaatgagcattttttttgttacaacaagatcaaaaatacatt
gatgatcttattaaaagaattaaagaagcaaaaacaaatattttaaaatgtaagtattgt
gctaattttacaaataaagacgaatgcgatatttgtttaaatgaatatcgtgattttact
aaattaatgattgttaccacaaacgaggatttagaaagaatcgaatcagctaacatttat
aatggcctatatcatattacaaatggtgaaatctctttaaggaaaaacgttgttattgaa
catacaaacattaagactattaaagagcgtgttttaaatggtagttttaaagaaataatt
attgctacaagttatacccatgatggggaagttacggctgattatattataagaatgctt
gaagacattaaagatttacaaatttatcgtattggctttggtattcctttaaattcaagc
attgattatgcagatgatgaaactttaaagcagtctcttattaataaacggaaaataaga
aattaa

DBGET integrated database retrieval system