KEGG   Ureaplasma parvum serovar 3 ATCC 27815: UPA3_0192Help
Entry
UPA3_0192         CDS       T00680                                 

Definition
phosphofructokinase family protein (EC:2.7.1.-)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
upa  Ureaplasma parvum serovar 3 ATCC 27815
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:upa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    UPA3_0192
   01230 Biosynthesis of amino acids
    UPA3_0192
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    UPA3_0192
   00030 Pentose phosphate pathway
    UPA3_0192
   00051 Fructose and mannose metabolism
    UPA3_0192
   00052 Galactose metabolism
    UPA3_0192
  Energy metabolism
   00680 Methane metabolism
    UPA3_0192
Enzymes [BR:upa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     UPA3_0192
Protein phosphatases and associated proteins [BR:upa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     UPA3_0192
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
223120..224085
Genome map
AA seq 321 aa AA seqDB search
MNQVNFLNLDKNILIITSGGDAPGMNASLISLIHRLMNNNFNVFIGIEGLLGLYNNLIEP
IKDKRVFDVYFNEQGTVIKTSRFIKLDINDKKTQIIKDNLLSHNIQKIIILGGQGSMQAG
LVLTKMGFEVFGILHTIDNDFSETQMCIGALSAASFNQKLLKCLNYTAKAHCAFNLVELM
GRECSWLVNNSVGKLKPILMLTNQDNKYTVDEVIDLIKDKINSIKEYDPLIIVQELIYDQ
KWYELLVKTFEQKLHKSLRITILNYLQRGAPVSDFDLQLAKDSANVLVDFIVNQNDIKNT
NNMYVVINKFDNKLEVIKFNK
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaagtaaattttttaaatttagataaaaatattttaattattacttcaggtggt
gatgcaccgggtatgaatgcttcattaatttcattaatccatagattaatgaataataat
tttaatgtttttataggaattgaaggattattaggactgtacaataatttaattgaacca
attaaagataaacgtgtttttgatgtttattttaacgagcaaggaacagtcattaagaca
agtagatttattaaattagatattaatgataaaaaaacacaaattattaaagataattta
ttaagtcataatattcaaaaaattattatcttaggcggccaaggtagtatgcaagctggt
ttagtgttaacaaaaatgggctttgaagtctttggaatattacacactattgataatgat
tttagtgaaacacaaatgtgtataggggccttaagtgctgcttcttttaatcaaaaatta
ttaaagtgcctaaattacacagcaaaagctcattgtgcttttaatttagttgagcttatg
ggtcgtgaatgttcatgattagtcaataatagtgttggtaaattaaaacctattttaatg
ttaactaatcaagataataaatatactgttgatgaagtaatagatttaattaaagataaa
ataaactcaataaaagaatacgatcctttaatcattgttcaagaattaatctatgatcaa
aaatgatacgaattattagtaaaaacttttgagcaaaaattacataaaagtttacgaatt
acaattttaaattatttacaacgcggagctccagtaagtgattttgatttacaattagca
aaagatagtgcgaatgtattggttgattttattgttaatcaaaatgatataaaaaacaca
aataatatgtatgtagttattaataagtttgataataagttagaagttattaaattcaat
aaatag

DBGET integrated database retrieval system