KEGG   Ureaplasma parvum serovar 3 ATCC 27815: UPA3_0300Help
Entry
UPA3_0300         CDS       T00680                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
upa  Ureaplasma parvum serovar 3 ATCC 27815
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:upa00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:upa00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(326707..327195)
Genome map
AA seq 162 aa AA seqDB search
MERLNMKLSDYPVLDIDKKLFNWSKVKNKLVLIVNVASKCGYAKQYEQLEYLYKKYKNKG
FIIVAFPCRQFMFQEFDDNNKIKEFCSTKYNVTFPIMDLTNVVGSNISPLYKQLITEYPW
SPKAKAVKWNFEKFFVKNDEIIGRFESKCEPNDLEEFIKNNL
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atggaaaggctaaatatgaaattaagtgattatccggtcttagatatcgataaaaaattg
tttaattgatcaaaagttaagaataaactagtcttaattgttaatgtagcaagtaaatgt
ggatacgctaaacaatatgaacaattagaatatttatacaaaaaatataagaataaagga
ttcatcattgtcgcttttccttgccgtcaatttatgtttcaagaatttgatgacaataat
aaaataaaggaattttgttcaacaaaatacaatgttacttttccaataatggatctaact
aatgttgtaggttctaatatttctccattatacaaacaattaattactgagtatccatga
agtccaaaagcaaaagcagtaaaatgaaattttgagaaattttttgttaaaaatgatgaa
attattggacgttttgaatcaaaatgtgaaccaaatgatttagaagaatttattaaaaat
aatttataa

DBGET integrated database retrieval system