KEGG   Ureaplasma parvum serovar 3 ATCC 27815: UPA3_0300Help
Entry
UPA3_0300         CDS       T00680                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
upa  Ureaplasma parvum serovar 3 ATCC 27815
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:upa00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    UPA3_0300
  Metabolism of other amino acids
   00480 Glutathione metabolism
    UPA3_0300
Enzymes [BR:upa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     UPA3_0300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(326707..327195)
Genome map
AA seq 162 aa AA seqDB search
MERLNMKLSDYPVLDIDKKLFNWSKVKNKLVLIVNVASKCGYAKQYEQLEYLYKKYKNKG
FIIVAFPCRQFMFQEFDDNNKIKEFCSTKYNVTFPIMDLTNVVGSNISPLYKQLITEYPW
SPKAKAVKWNFEKFFVKNDEIIGRFESKCEPNDLEEFIKNNL
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atggaaaggctaaatatgaaattaagtgattatccggtcttagatatcgataaaaaattg
tttaattgatcaaaagttaagaataaactagtcttaattgttaatgtagcaagtaaatgt
ggatacgctaaacaatatgaacaattagaatatttatacaaaaaatataagaataaagga
ttcatcattgtcgcttttccttgccgtcaatttatgtttcaagaatttgatgacaataat
aaaataaaggaattttgttcaacaaaatacaatgttacttttccaataatggatctaact
aatgttgtaggttctaatatttctccattatacaaacaattaattactgagtatccatga
agtccaaaagcaaaagcagtaaaatgaaattttgagaaattttttgttaaaaatgatgaa
attattggacgttttgaatcaaaatgtgaaccaaatgatttagaagaatttattaaaaat
aatttataa

DBGET integrated database retrieval system