KEGG   Ureaplasma parvum serovar 3 ATCC 27815: UPA3_0468Help
Entry
UPA3_0468         CDS       T00680                                 

Definition
holliday junction ATP-dependent DNA helicase RuvA (EC:3.6.1.-)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
upa  Ureaplasma parvum serovar 3 ATCC 27815
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:upa00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    UPA3_0468
Enzymes [BR:upa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     UPA3_0468
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(509662..510249)
Genome map
AA seq 195 aa AA seqDB search
MNYLIFKVIYANANIVVGEHNFIGYQIRIPKDYELEINKFCKLYLYEYISIMPNKNLIIK
DLYGFRTYNERLLFIDLISINSIGPKTAINILKYDIDTIIDAIATKNIDYLITIKGINQR
NANLICDQLNYKYINKVNDKNNWAKELSIGLENLGYTKKDIEYAITKVKINSQQDIDISE
IISSAIKEISLRHEN
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgaactatttaatttttaaagttatttatgcaaatgcaaatattgttgttggcgaacat
aattttattggttatcaaatacgtatcccaaaagattatgaattagaaattaataaattt
tgcaaattatatttgtatgaatatattagcataatgcctaataaaaatttaattattaaa
gatttatatggttttcgtacttataatgaacggttattatttatagacttgattagtatt
aattcaattggcccaaaaacagctattaatattctaaaatatgatattgatacaattatt
gatgcaattgctactaagaatatagattatttaataacaattaaaggaattaaccaacga
aatgctaatttgatttgtgatcaattaaattataaatacataaataaagtaaatgataaa
aataactgagctaaagaattaagtataggtcttgaaaatttaggatatactaaaaaagat
attgagtatgctattactaaagttaaaattaattctcaacaagatattgatattagtgaa
attataagctctgcaatcaaagaaatttcattgcgccatgaaaactaa

DBGET integrated database retrieval system