KEGG   Ureaplasma parvum serovar 3 ATCC 27815: UPA3_0640Help
Entry
UPA3_0640         CDS       T00680                                 

Definition
hypothetical protein
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
upa  Ureaplasma parvum serovar 3 ATCC 27815
Pathway
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:upa00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    UPA3_0640
Enzymes [BR:upa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     UPA3_0640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(748186..748983)
Genome map
AA seq 265 aa AA seqDB search
MKVKSFAKIDLGYSVYKKQKNFTKHDFESIFILVENIYDDIEITKIEKNIDDVHYYNETN
EIYVYSRLVHKTLEWIRHTYHIKNHYRINIKKRIPIGAGLGGGSSNAAAIMKYILEFEGI
KEINYKDVVNKLGADIPFFLSGYKTAYISDYGSVLEDLTGQFKLNYEVYLMNVNVNTKIV
FEKFDDNSWHVIKNNFKTIIKNLKENIVVNIHNDLQEYCFELYPNIKYKYNELLSDGFYT
ILSGAGSSFIRIKLKNKEDLIINEN
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtaaagtcattcgcaaaaattgatttaggatatagtgtttataaaaaacaaaag
aattttacaaaacacgattttgaatcaatttttatacttgttgaaaatatttatgacgat
attgaaattactaaaatagaaaaaaatattgatgatgttcattactacaatgaaaccaat
gaaatttatgtttatagccgtttagttcataagacattagaatggattcgtcatacttat
catattaaaaatcattatcgaattaatattaaaaaaagaattccaattggtgcaggctta
ggtggtggttcatcaaacgctgcagccattatgaaatatattctagaatttgagggtatt
aaagaaattaattataaagatgttgttaataaattaggtgctgatattccctttttttta
tcaggctataaaacagcttatataagtgattacggaagtgttttagaggatttgactggt
caatttaaattaaattatgaagtttatttaatgaatgttaatgtaaatacaaaaattgtt
tttgaaaaatttgatgataattcatgacatgttattaaaaataattttaaaacaattatt
aaaaatttaaaagaaaatattgtagttaacatacataatgatctacaagaatactgtttt
gagctataccctaatattaaatacaaatataatgaattattatccgatggtttttataca
attttaagtggtgcaggtagttcatttattcgcataaaattaaaaaataaggaagattta
attattaatgaaaattag

DBGET integrated database retrieval system