KEGG   Uncinocarpus reesii: UREG_00211Help
Entry
UREG_00211        CDS       T01132                                 

Definition
hypothetical protein
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
ure  Uncinocarpus reesii
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:ure00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    UREG_00211
  Lipid metabolism
   00062 Fatty acid elongation
    UREG_00211
Enzymes [BR:ure01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     UREG_00211
Lipid biosynthesis proteins [BR:ure01004]
 Fatty acid synthase
  Component type
   UREG_00211
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 324 aa AA seqDB search
MGIRAFGFASLLSSFFALVFSSPLPPSGASELAPLPLVIWHGLGDDFARDGLKQVSQLAE
DVNPGTFVHIIHIGSTPDDDRQATFLGNLTTQIETVCQQLARHPILSTAPAINALGFSQG
GQFLRGYVERCNNPPVRNLVTFGSQHNGIAKFRSCGTLDWLCHGAVALLKFGAWSNMAQS
RFVPAQYYRNPEELDQYLLHSNFLADINNERAFKNMQYKRNMISLNKFVMFMFKDDKMVV
PMQTSHFAEVNMTTGDVTPLREREIYKDDWLGLRTMDEAGKLEFLTIPGEHMQISDHVLT
KTFKQYFGPVEINSPDSKFVLQVQ
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgggaatcagagcatttggatttgcttccctcctttcttccttctttgcactcgtcttc
tcttcgccactccccccatccggcgcctccgaactcgcaccacttccgctcgtcatctgg
cacggcttaggcgacgacttcgcccgtgatggtttgaaacaggtttcgcagctcgctgaa
gatgtaaaccccggcaccttcgtgcacattatccatatcggctcgacgcccgacgatgac
cgtcaagctacatttctcggcaatctcaccacccaaatcgagactgtttgccagcagctt
gcacgccacccgatactcagcactgcacctgctatcaatgcattggggttttctcagggt
ggccagttcttgcgcggatacgtagagcggtgcaataacccgcctgtgcggaacctcgtc
acgttcggaagccagcacaatgggatcgcgaagtttcgatcgtgcggaactctggactgg
ttgtgccatggcgccgtggcgcttttgaaattcggcgcatggtcgaatatggcgcagtct
cggtttgtcccggcgcagtattaccgcaacccagaagaactcgatcaataccttctgcac
agcaattttcttgccgatatcaacaatgagcgggcgttcaaaaatatgcagtataagcga
aacatgatatctttgaataaatttgtcatgttcatgttcaaggatgacaaaatggtggtg
ccaatgcagacttctcacttcgccgaagttaacatgaccacgggagatgttacgcctttg
cgggaaagggagatttacaaggacgactggttaggcctgagaaccatggacgaggcggga
aagctcgagtttttgaccatccccggggagcatatgcagatatcggatcatgttttgact
aagacgtttaagcagtattttggccctgttgagattaattccccggattcgaagtttgtg
ttgcaagtgcaatga

DBGET integrated database retrieval system