KEGG   Uncinocarpus reesii: UREG_00274Help
Entry
UREG_00274        CDS       T01132                                 

Definition
similar to isoepoxydon dehydrogenase
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
ure  Uncinocarpus reesii
Brite
Enzymes [BR:ure01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     UREG_00274
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 975 aa AA seqDB search
MRLIPGFLNDQCGKNDLVVFIVLSLASAVYLAGKRSWSKQDPLHYRWFERRQETVLGRKR
KAERRKKDVSTRLSDERKDVVIFWGSQTGTAEGFANTLARTLRLRLRLDALVLDLAEVDP
QTISSISSNYPAIFLLSTYGEGNPSDNAVAFYKGLLRTETSLANIRYTGFGLGNSMYKAY
NRAIDDVTRRLDERGALQFCAIEYGDDAIGTTECSFLVWQDKLIDRLKEVFGCEENHLGY
EPSVEISEVLDRKSMDKAFLGHPFEIERNPTFSVPVTSACHALPIAVSRDLTPGGERRHL
HLEIDLSRRPELKYRTGDHFLIWPSNPESEVDRLLRLFGLEAQRSKIVTIKALAQGTAVK
VPSICSIEAIFRHYLSICGLVTRQLLRSLAQVAPDEMARSAVLNLCDDSVAFNNMHRRYS
TVADVMEMAIADRASWDTVPLSWAVENIPPMKPRPYSISSTPSTSPRRLAITAVVIDEAT
TGCGDVIKRGLTTTMLNGLNRSLQTTSQLSQSQQNPPPSFCYSENPDQHFKSGGIYGQIR
RSKFKPPISCTAPILMVAAGTGVAPFRAFIQERAWLKSIGKEVGRMTLFYGCRKSSEDFL
YVEELNKAVAALENAFEIVTAFSREQRRPNGHRTYVQHRIREFQSAVAQYIVNEGYFVYV
CGSARMAREVTNVVLEIVGNVHGWSEEKALSFLETAKKTGKWQEDVWGGTKGLGRGMVEA
LVKEGCNVSYCARTVRDDDFEDLHKSLLENAEFNGVSNGSGADRQLPKAYGTSVDIADRE
ALSWWVEAAGKAFGRLDIVIANGSHRSHIFDIASNMHFESTPKTWQSSFDLDVMGFVNLV
EAAVPWLERSPQPSIIVQSSFMGREFFRSPPAPYGACKAAQLQHVQELSHYLGPKGIRIN
AISPGPIWAKDGAWESYSKVAPDWVEEQRQKVPLKRFGTPEDIANLAVFLASPLSSYIQG
ANILADGGIHIGTCF
NT seq 2928 nt NT seq  +upstreamnt  +downstreamnt
atgcggttgattccaggattcctcaatgaccaatgtggcaaaaacgacctcgttgttttc
attgttctctctcttgcgtctgctgtttatctggccggaaaaaggtcctggagcaagcag
gatccattgcattaccgatggtttgaaagacggcaagagacagtcctcggtcgcaaaaga
aaagctgaacgtaggaagaaggacgtttcgacgagactgtcagacgagcgcaaagatgtt
gttatcttctggggttcccaaacgggaacagccgaaggtttcgccaacacacttgcacgg
actctccggctgcgattgcgattagacgccctagtccttgatctcgccgaagttgatcca
caaacaatctcttcgatcagctcaaattatccagccatatttctcttatccacctatggt
gaagggaatcctagcgataacgctgtcgcattttataaaggactgcttcgaacagagacg
tcactcgcgaatattcgctatacgggttttggcctcggaaacagtatgtataaagcatac
aatcgagcgatcgatgatgttactcgaaggctcgacgagcgaggagctctccaattctgc
gctattgaatacggcgatgatgccatcgggactaccgagtgtagctttctggtttggcaa
gataaactcattgatcgtttgaaagaagtgtttggttgcgaggagaaccacctagggtac
gagccatcggtggaaatatcagaggtgttagatagaaaatccatggataaagcgttcctg
ggacatccgttcgaaatcgagagaaacccaactttcagcgtacctgtcacatcggcgtgc
cacgcgctaccaatcgcagtgagccgtgatttgacacctggaggcgaacgacgacatttg
cacctggaaattgatctttcaaggcggccggaactcaaataccggaccggagaccacttt
ctgatttggccatcgaatccagaatctgaagtggaccggctgttgcgtttgtttgggctt
gaagcacagcgatccaagatcgtaaccatcaaagctttggcgcaaggaacggctgtcaag
gttcctagcatatgctcaattgaagccatttttagacactatttgtcaatatgtggactg
gtaactcgccaattgttacggtctctcgcccaagtcgctcccgatgaaatggccaggagc
gctgtgctgaatctctgcgacgattcggttgctttcaataatatgcaccgacgatattcg
acggtcgcggatgtaatggaaatggcgattgccgatcgagcgtcgtgggatacggttcct
ctttcttgggcagttgaaaatattcctcctatgaaaccaaggccgtattccatatcatca
actcctagcacttcgccaagacgacttgccattactgctgtggtgattgatgaggcgaca
acaggttgtggagatgtgatcaaacgagggttgactacaaccatgctgaatgggctcaat
cgatcactccagaccaccagccaattatcacagtcgcaacaaaaccctcctccatcattt
tgttattccgagaacccagaccaacacttcaaaagcggtgggatatacggccaaatacgg
agatcaaaattcaagccacctatttcatgcacagcaccgatactgatggtcgcagcaggg
acaggcgttgccccatttagggcattcattcaggagagggcgtggttgaagtcaatcggc
aaggaagtgggtcgaatgacgctcttctatggatgtcgcaagagcagtgaagacttcctg
tatgtcgaagagctcaacaaagccgtagctgccctcgaaaatgcatttgaaattgtaact
gcattttcgcgtgagcaacggcgtccaaacgggcatcgaacgtatgttcagcaccgaatt
cgcgagtttcagtcagcggtagcccagtacatcgtaaacgagggatattttgtttacgtt
tgtggctccgcaaggatggcgcgggaggtgacaaacgtggtccttgagatagtcggaaat
gtccatggatggagcgaggaaaaagctttgagtttcctggagacggccaaaaagacaggg
aaatggcaagaggatgtctggggcggcaccaaaggtcttggtcgcggtatggttgaggct
ttggtaaaagagggttgtaatgtctcatactgtgcgcgaacagtgagggatgacgatttc
gaggacttgcacaaatctctgcttgaaaatgccgaattcaatggtgtttcaaacggttcc
ggagccgatcggcagttacctaaggcgtatggaacatcagttgacatagctgaccgtgag
gctctgagctggtgggttgaagctgcgggcaaggcattcgggcgccttgacatagtcata
gccaacggttctcatagaagccatatttttgatatagcgtccaatatgcatttcgagtct
acgcctaaaacgtggcagtcctcgttcgatctcgatgtcatggggttcgtgaacctggtt
gaagcggcagtgccttggcttgaaaggtcgccacaaccctcaatcatcgttcagtcgtca
ttcatgggtcgtgagttttttcgcagtcctcctgcgccctacggtgcgtgcaaggctgca
cagcttcaacatgtccaagagctatcccactaccttgggcctaagggaatcaggatcaac
gcaatctctccggggcccatatgggccaaagatggagcatgggagagttatagcaaagtg
gctccagattgggtagaagaacagaggcagaaagtgccgctcaagaggtttgggactcca
gaagatatagcgaatcttgcggtcttccttgctagtccgctaagtagctacatccaaggc
gcaaatattctggcagatggaggcattcatatcggcacttgcttttag

DBGET integrated database retrieval system