KEGG   Uncinocarpus reesii: UREG_00281Help
Entry
UREG_00281        CDS       T01132                                 

Definition
hypothetical protein
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
ure  Uncinocarpus reesii
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ure00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    UREG_00281
Enzymes [BR:ure01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     UREG_00281
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 381 aa AA seqDB search
MLLVFGLSFVLFSGSCLGRNIVFPPIHAVPVQAPLTTDNLENIDIITGSQFSGLSTFAHV
PYVNCFVDSEAEKEKYDIAFLGAPFDTGVTARPGARYGPGGIRQGSTRMKVESAWNIYTG
VNNLLSWAKIVDCGDAPLTFLDNTIALKQLDKAHKVISSRIANSTDISLVPRIITLGGDH
TTTLSALRSTYEKWGPVSVIHFDSHIDTWDPTVLGGGISDYAGVNHGTFLHIAHEEGLIR
NDSIHVGIRAPLIRRKGDLRNDIRCGFDMITARDIDLIGTSGIIQKIKDRVGSNNVYISV
DIDVLDPAYAPATGTAEPGGFSTRELLTIIDGLRGLPVIGGDVVEVAPIYDTRGETTVLA
AAEIANSLLGLMIAMPVPVKG
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgctccttgtctttgggctgtctttcgtcttgttcagcggcagctgtcttggccggaat
atcgtctttcctccaattcacgctgttcctgtgcaggcgcctctaaccacagataatctt
gagaatatcgatatcataactgggagccagttctcgggattatcaacgttcgctcacgtt
ccatatgtcaactgctttgtggatagtgaagcagagaaggagaagtatgatattgctttc
cttggagcgccgtttgacacgggtgtaactgctcggccaggtgcgaggtatggtcctgga
ggcatccgacaaggttccacgcgaatgaaagtagaaagcgcttggaacatatatacagga
gtaaacaacctcctcagttgggccaaaattgtggattgcggtgatgcaccgttaaccttt
ttggacaataccattgccttaaaacagcttgataaagcccataaggtcatttcatcgcgc
atagccaattcaacggatatatccttagtcccaaggatcatcaccctcgggggtgaccac
actaccaccctttctgcgctacgatcaacttatgaaaaatggggtccggtttcggttatt
cactttgatagccatatcgatacttgggaccccacggttttaggcggtggaatctccgac
tatgcaggagtaaaccatggcactttcttacatatcgcccacgaagagggtcttattcgc
aacgattcaatccacgtgggcattcgggcccccctcattcgacgtaaaggcgatctccgc
aatgatatccgatgcggttttgatatgatcacggctcgggatattgacttaattggcaca
tctgggatcattcaaaaaattaaagatagagtcggctcaaacaatgtgtacatcagcgtt
gatattgatgtcctagatcctgcatatgcgccagccaccgggactgcagagcccggcggg
ttttccacccgcgaattactcaccatcatagacgggttacgcgggcttcccgtcatcggc
ggcgatgtcgtagaagtcgcgccaatttatgacacaagaggcgaaacgacagttctcgca
gcagctgagatagccaactctttgttgggcctcatgattgcaatgcctgttcctgtcaag
ggataa

DBGET integrated database retrieval system