KEGG   Uncinocarpus reesii: UREG_00315Help
Entry
UREG_00315        CDS       T01132                                 

Definition
hypothetical protein
Orthology
K10739  
replication factor A2
Organism
ure  Uncinocarpus reesii
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ure00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    UREG_00315
   03420 Nucleotide excision repair
    UREG_00315
   03430 Mismatch repair
    UREG_00315
   03440 Homologous recombination
    UREG_00315
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 252 aa AA seqDB search
MNEVGSSQSGKKATKESLRPVTIKQLNDATQAYTDAEFKIDDTEITQVSFVGQVRNISQL
STFTTYKLDDGTGEIEVKRWLDRSDGMQADPMDTDSAATKRPDKNQIVTNGYVKVWGKLS
SYSNNRRSVTAVVIRPLTSMDEYHCHFLEATSIHLYFTRGPPPNKDKPEAGKGQGSGMTV
TGKPLPALSPMGTKLYEALSNTLQSREGLHVQQLASMLNASTSDVRKTCDELAEQGLIFT
TVDEFTWAVMEF
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaagtgggaagtagtcagagtggaaagaaagccaccaaggagtccctccgacca
gtaacgattaagcagctaaacgacgcaacgcaagcctatacagatgcagaattcaagatc
gatgatacagaaatcacacaagtctcattcgtgggccaagtccgcaatatctcccaacta
agcacctttaccacatacaaactggacgatgggacgggcgagatcgaagtgaagcgatgg
ttagaccgaagtgacggcatgcaggcagatcccatggacacggatagcgccgcgacaaaa
aggcccgacaagaaccaaattgtgacgaatggatacgtcaaagtctgggggaagctgagt
tcgtatagcaacaatcgccgatcagtcacagcggttgtaattcggcctctgacgagtatg
gatgaataccactgccatttccttgaagctacgtcgatacacctttattttacgcggggc
ccgcctccaaataaagacaaacccgaagctgggaagggccaaggctcgggtatgactgtc
actggtaaacctcttccggcgttgtcgcccatgggcacgaaattatatgaggctctcagc
aataccttacaaagcagagaaggactacacgtacagcaactggcgtcgatgctcaatgcg
tcgacgagcgatgtccgcaaaacttgtgatgagttagcggagcagggcttgatctttacc
acggtggatgagtttacatgggctgtcatggagttttag

DBGET integrated database retrieval system