KEGG   Uncinocarpus reesii: UREG_00487Help
Entry
UREG_00487        CDS       T01132                                 

Definition
hypothetical protein
Orthology
K06101  
histone-lysine N-methyltransferase ASH1L [EC:2.1.1.43]
Organism
ure  Uncinocarpus reesii
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:ure00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    UREG_00487
Enzymes [BR:ure01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     UREG_00487
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 727 aa AA seqDB search
MARGPMVSRSSTDTSSTVDSDTTIDATVPVLTPATSVSEPSTPADSKDGHEDRKKESAAS
RRVTRSSLRTMEFEENGYTVDQGDLSSRFVPTGAEAKDTNQKAEDGCLDGCKAGETMSVA
PLSDCSGDIRVPYGEEPTKTMEHHPASRGEAGILSEYKNPRRRSTRLTVRQEGREVTVNA
SSAPGKRTFDAISKNTHKIKELDRRASLRPRVESQKDSAPAPQPPPAKKRRVSDGDKPIS
QSSATEHTPRENSLIRRKKKLWLRHGLYAGQEYVDPSAPSSRKRRAYSKKGEGQQANVFP
LPMYAGARLLENGRSYKLPFDIFSPLPHGQPKPDEWRKANKNVFVGDATSIWKANKIKEH
STCTCTPETGCDENCHNRYMFYECDDTNCKLGPELCQNRPFSELRRRSKAGGKFNIGVEV
IKTEDRGYGVRSNRAFNPNQIIVEYTGEILTQEECERRMRTVYKKNDCYYLMYFDQNMVI
DATRGSIARFINHSCEPNCRMEKWTVAGKPRMALFAGEDGIMTGEELTYDYNFDPYSQKN
VQECRCGAPTCRGVLGPRQKEAFKNKEKDKGSKTRTTGSKRKSSNAPDRQARRNKKQRLS
ESTSPKPGRGNTVSKTRTALKSAQSNIVHEPAARKARKTRTVQPIPVKKRGAALTRAKMP
AKRGRKPGKASQTQTQTNSRKLNMPSKPRLNSIAAARASETGTKEENECCPRFREYLSER
ADFTKAW
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atggcacgaggccccatggtctcacggtcttccaccgatacctcttccaccgtggatagc
gacacgacaattgacgcgactgtccccgttcttacccctgccacgagcgtatccgagccg
tctactccggcggattctaaggacggtcatgaagaccgcaagaaagaatccgccgcttca
cgacgcgtcacgcgttcgtcattgaggacaatggagttcgaagagaacggatatacggtc
gatcaaggggatttatcttctcgttttgtccctaccggcgcggaagcgaaggacacaaac
cagaaggctgaggatggttgccttgatggctgcaaagcaggtgaaactatgagcgttgca
cccttatctgactgctccggagacatacgagtgccttatggcgaagagcctacgaaaaca
atggaacaccatcccgcttctcgcggggaagcaggaatattgtcagaatacaaaaacccc
agaagacgatccacgcgcttgactgtacgccaggaaggaagagaagtgacggtgaatgct
tcttcggcgcccgggaaacggacatttgacgctatatcaaaaaacacgcacaagatcaag
gaacttgaccggagggcaagtttacgacctagagtggaaagccaaaaggactcggctcca
gctccgcagccgcctcctgctaagaaacgacgtgtatcagatggtgacaagcccatttcg
cagtcttccgcaacggaacacactcccagagagaatagtttgatccgccggaaaaagaag
ctctggcttcgtcacgggctatatgctggacaggaatatgttgacccttctgcccctagt
tcaaggaaacgcagagcatattcaaaaaagggagaaggccaacaagcgaacgtttttccg
cttccaatgtatgccggtgctaggctcttggaaaacggccggagttacaagctacccttt
gatattttctctcccttgccacatggacaaccaaaaccagatgaatggcggaaagccaat
aaaaatgtattcgtcggtgatgcgacatcaatatggaaagccaataagatcaaggagcat
tcgacgtgtacgtgcactcctgaaacaggatgtgatgaaaattgccataaccgatatatg
ttctatgaatgcgatgatacgaattgcaagcttggtccagaattatgccaaaatcggccg
tttagtgagctacggaggcgctcgaaagcagggggcaaattcaacatcggagttgaggtt
atcaaaacagaagatcggggctacggcgtccggagcaatcgtgcttttaacccgaatcaa
atcattgttgaatacacaggagagatcctcacacaggaagagtgcgagcggagaatgagg
acagtctacaagaagaacgactgctactatctcatgtacttcgaccagaatatggtcatc
gatgccacccgtggctcgattgcccgcttcataaatcattcctgcgaacccaattgtagg
atggagaagtggactgttgctggaaaaccgcgtatggccctttttgcaggcgaagatggg
atcatgaccggagaagaactgacatacgactataattttgatccttattctcaaaagaac
gtgcaggaatgtcgatgtggagctccaacttgccgaggagtcttaggcccaaggcagaaa
gaggcatttaaaaataaagagaaagataagggatctaagacacgcacgactggttcgaag
cgcaagtctagcaacgctcccgataggcaagctcgacgcaacaagaaacagagactctca
gagtctacctccccaaagcctggaaggggaaatacggtctcaaaaacccgtacagcgctc
aaatcagcgcaaagcaatatagttcatgagccggcagcgagaaaagccagaaaaacgagg
accgtccaaccaattccggtaaagaagcgcggcgctgctctcacgcgtgccaaaatgcct
gccaaacgtggtcgaaaacctggtaaagcgagccagacacaaacacaaaccaacagccgg
aaactcaacatgccttctaagccaaggcttaactcgattgctgcggcgcgcgcctcggag
acggggacgaaagaggaaaacgaatgctgtcccagattcagggaatatctcagtgaaaga
gccgactttacgaaagcgtggtag

DBGET integrated database retrieval system