KEGG   Uncinocarpus reesii: UREG_00550Help
Entry
UREG_00550        CDS       T01132                                 

Definition
hypothetical protein
Orthology
K00493  
unspecific monooxygenase [EC:1.14.14.1]
Organism
ure  Uncinocarpus reesii
Pathway
Fatty acid degradation
Tryptophan metabolism
Brite
KEGG Orthology (KO) [BR:ure00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    UREG_00550
  Amino acid metabolism
   00380 Tryptophan metabolism
    UREG_00550
Enzymes [BR:ure01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     UREG_00550
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 605 aa AA seqDB search
MLTAYSLFSTGLLAVAIITILLLFVAAYLFSPPGSFPRNIPTIPFYYALLPLVKDNDQEV
LYRRYLEPLFEKHGAAKIFFGGRWNILVQRPSYIAEVFKFEDIYAKSGNHVKIPHSVLAE
YTGDNIISAHGENWKLYRSVLQPPLQQDQDPEPIWRNARLLIDLLFEEQKSSAGGSVLLP
QLLQRYTLANLAEGLLGTSFETLQRKDAALHEFQMQIKPLIFSPVFMNFPFLDHLNLPSR
KKARQLARQFASKLCAVVQQGHQHAHNDKSTSNVGCSVIGAFEEGILTEKQFRNNMVSVF
LAGHENPQLLLVSMIFLLGEHQAVQEKVRRELFSLGDDELAYPVLQSAPYLTSVIYETLR
MYPPISQLINRCTTRPVLLGGKIPLPAGTYVGYNAYATNRDQEFWGADADEFKPERWGQT
AEDINTMFRKANAKGAFISFHGGRRVCLGQKFAMFEARITMAAVLRSVEWKIDPAWPRMM
TPVSNKIQSHDATDINSVGIDRLGHCIREICESDSSGSARNIPNGTMLIYPNSTGTDRQY
HARSERAIPKSNRPAPAGREEALNLENAPCLDSSAMFIDHSSALATCASKCCVPVSLNTA
AQPLP
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgctcacagcatactctttattttctactgggttactagcagttgccattattactatc
ctccttctctttgttgctgcatatttgttcagtcctcccggcagtttcccaaggaatata
cccactatccctttttactatgcgcttcttcctctcgtcaaggacaacgaccaggaggtt
ctttaccgcagatacttggagcctctttttgagaaacatggagcggcaaaaatattcttc
ggtggtcgatggaatatcctggtccagcgcccgtcctatattgctgaggttttcaagttt
gaagatatctatgccaaaagcggaaaccatgtgaagataccccatagcgtgttggcggaa
tacaccggagacaacatcatcagcgcccatggtgagaactggaagctataccggtcggtt
cttcagccaccacttcaacaggatcaggatccggaacctatttggcgcaacgctcgtctc
ctcattgacctcctgttcgaggagcaaaagtcgtccgcggggggttccgttttgctgccg
caactccttcaacggtatactttggccaacctcgcggaaggacttctcgggaccagtttc
gagactttacaacgaaaggacgcggctcttcacgaatttcagatgcaaatcaagcctttg
attttcagccccgtcttcatgaactttccctttctagaccatttaaatctccccagccgg
aaaaaagcacgtcaacttgcgagacagttcgccagcaaactctgtgcagtggtgcaacaa
ggccaccaacatgcgcacaatgacaagtcgacctcaaatgtcggctgcagtgtaatcggg
gcatttgaagaagggattctgacggaaaagcaattcagaaacaacatggtcagcgttttc
ctagcaggccatgaaaacccccagctcctgcttgtttcgatgatattcctgcttggcgag
caccaggcggtccaggaaaaggtccgcagggagctattttcgcttggagacgatgaactg
gcatatcccgtcctccaatcggctccatacttgacgtctgtgatatacgagactttacgg
atgtatccgccaatttcgcaactcatcaatcgatgcacgaccaggcccgtgcttttagga
ggaaaaatccctctgccagccggcacgtacgtgggctacaatgcctacgcaaccaacagg
gatcaagagttctggggagcagatgccgatgagtttaaacctgagcgctggggtcaaaca
gccgaagatatcaacaccatgtttaggaaagcgaacgccaagggggcattcatctcgttc
cacggagggaggcgagtatgccttggacagaaattcgcgatgttcgaagcaaggatcacg
atggcggcggtgttacggtctgtggagtggaagattgatcctgcatggcctcgaatgatg
acgccggtgagtaacaaaatccaaagtcatgatgcaacagatattaatagcgtggggatc
gacaggctgggccactgtatccgagaaatctgcgagtccgattccagcggatcagcaagg
aatattcctaacggcacaatgcttatatatcccaacagcactgggacagacagacaatac
cacgcccgtagcgaacgagcaatcccgaaatcaaatcggcctgctcctgctggtagagag
gaagccctgaatctagagaatgccccttgtttagatagttcagccatgtttatagaccat
tcaagcgctctcgcaacctgcgcctcgaaatgctgtgttcccgtcagccttaacacagct
gctcagccgttgccgtag

DBGET integrated database retrieval system