KEGG   Uncinocarpus reesii: UREG_00602Help
Entry
UREG_00602        CDS       T01132                                 

Definition
histone acetyltransferase GCN5
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
ure  Uncinocarpus reesii
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 434 aa AA seqDB search
MPTLTRTGKRKATDEPSTPDSKQRVKRARTESPDSQIKPQLKIVPFAEKPAVLEERRGDI
EFRVVNNDGTRESFIILTGLKCIFQKQLPKMPKDYIARLVYDRTHLSIAIIKHPLEVVGG
ITYRPFRGRAFAEIVFCAISSDQQVKGYGAHLMSHLKDYVKATSDVMHFLTYADNYAIGY
FKKQGFTKEINLDKAIWMGYIKDYEGGTIMQCTMIPKIRYLESGRMILKQKEAVHAKIRA
FSKSYIVHAPPKEWRNGICEIDPLSIPAIKESGWSPDMDELARQPRHGPNYNQLLHLLND
MQNHSAAWPFAQPVNRDEVPDYYEVIKEPMDLSTMEEKHEKDLYPTPQDFIKDAMLIFDN
CRRYNDESTSYAKSANKLEKFMWQQIKAIPEWSVSALYQLRAFRIPLTQSDLLAFGGWPL
TEPGRHIRNDMAIV
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgccgacactcacccgcacaggaaagcgcaaggccacggacgaaccgagtaccccagat
tccaagcaaagggtcaaaagggctaggaccgagtctccggattcccaaatcaagccccag
ctgaaaatcgtaccgtttgcggagaagcccgcagtgttggaagaaagacgaggcgatata
gaattccgagttgttaacaatgacggaaccagagagagcttcattatcctcacgggcctc
aaatgtatattccaaaagcaacttccgaaaatgccgaaggattatatcgcgcgactggta
tatgacagaacgcatttatcgattgctataataaaacaccctttggaggtagtcggggga
atcacatatcgaccgttcagaggaagagccttcgcggaaattgtattttgcgccatatct
tctgatcagcaggtaaaaggttatggtgctcatttgatgtcgcatttaaaggattatgtg
aaagctacctctgatgtgatgcacttcctcacatatgccgacaactatgccattggatat
ttcaaaaagcaaggattcacgaaggaaatcaacctcgataaggcaatctggatgggctat
atcaaggattacgaagggggaaccatcatgcagtgtactatgattccgaagatccggtac
ctcgaatctggacgcatgattttaaaacaaaaagaagctgtacacgccaaaatccgtgcg
tttagcaagtcctatattgtccatgcaccaccaaaggaatggagaaacgggatctgcgaa
attgatccgctcagcatcccagctatcaaagagtctggatggtctcctgacatggatgaa
ctagcccgccagccgcgccacggacctaattacaatcaacttttgcacctgctaaatgac
atgcaaaaccacagtgcagcatggccttttgcacagccagtgaatcgggatgaagttcct
gactattatgaggtaataaaggagccgatggacctgtcaacgatggaggaaaagcatgag
aaggatctctacccgactccgcaagatttcatcaaggatgcgatgctcattttcgataac
tgccggcggtataacgacgagagtacgtcctacgctaaaagcgcgaacaagctggagaaa
tttatgtggcagcagattaaggctatcccagagtggtcagtaagtgcgctctatcaacta
agggcgtttcgtattccgctgacgcaatccgatttgttagcatttggcggatggccattg
actgagcctgggcgccatataaggaatgacatggcgattgtttaa

DBGET integrated database retrieval system