KEGG   Uncinocarpus reesii: UREG_00623Help
Entry
UREG_00623        CDS       T01132                                 

Definition
CREB protein
Orthology
K11872  
ubiquitin carboxyl-terminal hydrolase 9/13 [EC:3.1.2.15]
Organism
ure  Uncinocarpus reesii
Brite
Enzymes [BR:ure01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     UREG_00623
Peptidases [BR:ure01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   UREG_00623
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 738 aa AA seqDB search
MLQDAGPLRNDGSDKFFGMENAQFGNTCYCNSILQCLFYSVPFRESVINYPRRSPPGVLT
DALANNLHYPDPNIPLEELLKPKQPPNATPKPNTPGKPVNAPPAQQHKPEDKDSGEYKKK
VALHTLPLLETTDNSASYGMKESLFTSLKDMFEAVAASPERMGVIRPYHFLEVLRREHEM
FRTTMHQDAHEFLNLLLNEVVSNVEAAQLLSDADEESDDSEGASERTATDSSVSTVPSKS
QNTRWVHELFEGTLTSETQCLTCETVSQRDEVFLDLSVDLEQHSSVTACLRKFSEEEVLC
ERNKFHCDNCGGLQEAEKRMKIKRLPKVLALHLKRFKYSEELDRLQKLFHRVVYPYYLRL
FNTTDDAEDPDRLYELYAVVVHIGGGPYHGHYVAIIKTVDRGWLLFDDEMVEPVDKSFVR
NFFGDRPGLGSAYVLFYQETTPEAMARELAKEKAQTPRNAAESKDCTSSLAKANGQSVSP
AKIDRTKSAVDAIPTTETVPLMSTTTAPANLAPNPGEMVSTSPPNTTPKIKSPSPFSIPN
ISEMRMKFERSRAGKEEEKQKKEHEREQKKQTKDARELEESQLRAALAQSRVSKAREDQL
NAAKAEKENTKGGLNRFRLGSRSISQSKIFNREKGNNTAPPPDAPPVPPVPPLNSMPEST
TDVSSPGQPSNASTDDDKDDSTNATTVSTQERKSLNYRADTLPKIPHISSNGDLKKSRRE
PSSKRSRFNLRKKSFSVF
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atgctgcaggacgctgggccgctacggaatgatgggagtgacaagttttttggaatggaa
aacgcgcaattcggtaacacctgttactgcaactcgattcttcagtgtctcttctactcc
gtcccgttccgagagtccgtgatcaattaccctcgacgctcacctcctggagtcctaacc
gatgccctggccaataaccttcattaccccgatccgaatatccccctcgaagaacttctc
aaaccgaaacagccgccaaatgcgacaccaaaaccgaatacacctggaaagcctgtcaac
gcccctcccgcccagcagcataagccggaggataaagactcgggggaatacaaaaagaag
gttgccctgcatacactccccttgctagaaacgacagacaattccgctagctatgggatg
aaagagtcgctcttcacttcgctaaaagacatgtttgaagccgttgccgcgagtccagaa
cggatgggcgtaattcgcccatatcacttcttggaggttctgcggcgagaacacgaaatg
ttcagaacaactatgcaccaggatgcccatgagttcctcaatctgctcctgaatgaagtc
gtatctaacgtagaggctgcccagcttttgtccgatgcggacgaggaatctgatgatagc
gagggagcatccgaacgaaccgcgacggacagctctgtttccacagttccttccaaatcc
caaaacactcgatgggtccacgaactctttgaaggaaccttgacctcagaaacgcaatgt
ctcacgtgtgaaactgtttcacaacgagatgaagtgtttctcgatttatccgttgacctc
gagcagcattcatcggtgacggcgtgtctgcgaaaattctcagaggaggaggtcctctgt
gaacgcaacaagttccactgtgataattgcggaggcctgcaagaggcagagaaaagaatg
aaaattaaacgtttacccaaagttttggcactacatctaaagagattcaaatattccgaa
gaattagaccgactgcaaaagttatttcatcgagtggtatacccttactatttacgttta
tttaacacaacagatgatgctgaagacccagatcgcctctatgagttatacgctgtcgtg
gtgcatattggcggtgggccgtatcatgggcactatgttgctatcataaagaccgtggat
agaggctggcttctcttcgacgacgagatggtcgaacccgtcgataagagtttcgttcga
aatttcttcggagatcgccctggcctaggttctgcctacgtgctattttaccaagagacc
acgcctgaagcaatggcgcgagaattagccaaagagaaagcgcagactcctcgaaatgcg
gcggaatcgaaagactgtacctcttccttggcgaaagcgaacggacagtcagtgtctccg
gcaaagatagatcgaaccaagagtgctgtggacgcaatacctaccaccgagacagttccg
ctgatgtcaacaacaactgcacccgcaaatctcgctccaaaccccggggaaatggtgtcc
acctcgcctcctaatactacgcctaaaataaaatctcccagccccttttctatccccaac
ataagcgaaatgcggatgaaatttgagcggtcgagagcggggaaagaggaagaaaagcag
aaaaaggagcatgaaagggagcaaaaaaagcaaaccaaagatgccagagaattggaggaa
tcccagctcagagccgcattggcacaaagtagagtttcaaaagcccgggaggatcaactc
aatgccgccaaagctgaaaaggaaaacacaaaaggtggccttaatagattccgacttggg
agtaggagcatcagccagtccaagattttcaacagagagaaggggaataatacagccccg
ccgccagacgctccgcctgtaccgcctgtaccgcctctgaacagcatgccagaatcgact
acagatgtctcgtcccctgggcagccgtccaatgcttcaacggatgacgacaaagacgat
tcgacgaacgccaccactgtctccacgcaggaacggaaatctctcaactatcgtgctgat
acattgcccaagatccctcatatcagcagcaatggtgatctcaaaaagtctcgacgagaa
ccctcctcaaagcgaagccgtttcaatttacggaaaaaatcctttagtgtattctag

DBGET integrated database retrieval system