KEGG   Uncinocarpus reesii: UREG_00733Help
Entry
UREG_00733        CDS       T01132                                 

Definition
histone acetyltransferase ESA1
Orthology
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
ure  Uncinocarpus reesii
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 513 aa AA seqDB search
MGVKDTSQEASSTPDPEKSLATLNTLRIGVKAFVEKDGDCRKAEILSMRQRKDGPSFYVH
YVDFNKRLDEWVSASRIDLTKEVEWPLPEKPEKKKVSGAAATKAQPKNALKRARQPSREV
SSTPDVLAGKNLNISKPSKLSKAGGKENQEEGTPLSIPPLTISADGTPQGEADSEDVDMI
DITEAEAKAAVKEEVEKAAEDAVRQEEIEKLRTGGSMTQNPTEIHRVRNLTRVQMGKYEI
EPWYFSPYPASFSDADMIYVDEFCLSYFDDHRAFERHRSKCTLVHPPGNEIYRDDYVSFF
EVDGRRQRTWCRNLCLLSKLFLDHKTLYYDVDPFLFYCMTTRDAHGCHLVGYFSKEKESA
EGYNVACILTLPQYQRRGYGRLLIAFSYELSKREGKLGSPEKPLSDLGLLGYRQYWRETL
VELLLEPGREAISESELASLSGMTEKDVHETLVVLNLLRYNKGNWVIVLTDAIVEQHNKR
LAKEQAKGVRKIDASRLQWKPPVFTALSRTWNW
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgggtgtcaaagatacatcccaggaggcctccagcacgccagaccccgaaaagagcctt
gctactttgaataccctcagaatcggcgtgaaggcgtttgtcgagaaggatggcgattgt
cgaaaagcagagattctgtctatgaggcagcgaaaagatggcccgagtttctatgtgcat
tatgttgatttcaacaagcgtcttgacgaatgggtatctgcgtcgcggattgatttaacg
aaagaggtagaatggcccctgcctgagaagccggagaagaagaaggttagcggtgcggcc
gcaaccaaagcacagcccaagaatgcattaaagcgagcacgacaaccgagcagagaggtt
tcatcgaccccagatgtcctagcaggcaagaatctgaacattagcaagccatccaaactc
tctaaagctgggggtaaggaaaatcaggaagaaggaaccccgttgagcattcccccctta
acaatctctgcagacgggactccgcaaggggaggcggactctgaagatgtggatatgata
gatatcacagaggccgaagccaaagcagctgtcaaggaagaggttgaaaaggccgctgaa
gacgctgtacggcaagaggaaatcgagaaactgaggaccggaggcagcatgacacaaaac
cccacagagattcaccgggtacgaaatttaactcgagttcagatgggaaaatatgagatc
gagccgtggtatttttcaccctatccagcgtcgtttagcgatgcggatatgatttatgtg
gacgaattttgcctcagctatttcgacgatcatcgtgcttttgaaagacaccggtcaaaa
tgcacacttgtccacccgccaggcaacgaaatctatcgtgatgattacgtatcatttttt
gaagtcgatggccgccggcaacggacgtggtgtcgaaacctttgcctcctgagtaaatta
ttcttggaccacaagaccctctactacgatgtggacccattcctattctactgcatgact
acacgggacgcgcacggctgccatctagttggatatttttccaaggaaaaggagtctgct
gagggctacaacgttgcatgcatccttacgctacctcaatatcaacgtcgaggatatggt
cgtcttctcatcgcatttagttacgagctcagcaaacgagagggtaaattaggatctccc
gaaaaaccactcagtgaccttggtctactaggctatcgacaatactggagagaaacgctg
gttgaacttctcttagagccaggccgtgaggcaatcagcgaaagcgaactggcaagttta
agtggtatgactgagaaagatgttcatgaaacattggtcgtcttgaaccttctcaggtac
aataaaggaaattgggtcatcgttctcaccgacgcaatcgtcgaacaacataataagcgt
ttagcaaaagagcaggctaaaggcgtccgaaaaatcgacgcttcacggcttcaatggaag
ccgccagttttcacagcattaagtcggacgtggaactggtaa

DBGET integrated database retrieval system