KEGG   Uncinocarpus reesii: UREG_00789Help
Entry
UREG_00789        CDS       T01132                                 

Definition
(RefSeq) acetyl-CoA carboxylase
  KO
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
ure  Uncinocarpus reesii
Pathway
Fatty acid biosynthesis
Aflatoxin biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:ure00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    UREG_00789
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    UREG_00789
   00640 Propanoate metabolism
    UREG_00789
  Lipid metabolism
   00061 Fatty acid biosynthesis
    UREG_00789
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    UREG_00789
Enzymes [BR:ure01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     UREG_00789
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     UREG_00789
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 2288 aa AA seqDB search
MPETTNGYGSSYAAKHNLPSHFIGGNRLDLAPPGAVKDFVAQHDGHSVITSVLIANNGIA
AVKEIRSVRKWAYDTFGDERVIQFTVMATPEDLEANADYIRMADRYVEVPGGTNNNNFAN
VELIVDIAERMGVHAVWAGWGHASENPKLPESLAASPKKIIFIGPPGSAMRSLGDKISST
IVAQHAGVPCIPWSGTGVDEVRVDDNGIVTVEDSIYDLGCTHSPQEGLEKARAIGFPVMV
KASEGGGGKGIRKVEREEDFVNLYNAAASEIPGSPIFIMKLAGNARHLEVQLLADQYGNN
ISLFGRDCSVQRRHQKIIEEAPVTIAKPATFQAMERAAVRLGKLVGYVSTGTVEYLYSHA
DDKFYFLELNPRLQVEHPTTEMVTGVNLPAAQLQIAMGIPLHRIRDIRLLYGVDVNTSSE
IDFDFANEDSLKAQRRPQPKGHTTACRITSEDPGEGFKPSSGTMHELNFRSSSNVWGYFS
VGTSGGIHNFSDSQFGHIFAYGENRSASRKHMVMALKELSIRGDFRTTVEYLIKLLETPA
FEDNTITTGWLDELITKKLTAERPDPVVAVICGAVAQAHVASEACIAEYKKGLEKGQVPA
KDVLKTVFTIDFIYEDTRYKFTATRASSDSYHLFINGSKCLVGVRALADGGLLVSLNGRS
HNVYWKDEPAAIRLSVDGKTCLLEEENDPTQLRTPSPGKLVHYTVENGAHVNAGEVFAGI
EVMKLYMPLIAQEDGVVQFIKQPGATLQAGDILGILTLDDPSRVKHAQPFLGQMPDMGLP
QVVGNKPPQRFKLLHNILQDILLGFDNQVIMSPTLAELVDVLREPDLPYGEWNAQVSALH
SRMPQKLDAQLTQVIEKSKIRKSDFPAALLMKTFTRFLDDNVSPADAESLKVTLDPLIQV
IQDYSEGLRVHEYNVIAALLEQYWNVEHLFAQRNIRDEDVILKLRDEHRDDIGNVIQTVL
SHSKVGGKNNLVLAILETYRPNKPTTPNVGKYLKPILKKLADLESRACAKVALKARELLI
QCALPSLEERMAQMEHILRSSVVQSKYGETGWDHREPDIDVLKEVVDSKYTVFDVLPLFF
GHQDQWVSLAALEVYVRRAYRAYDLQGVQYHNDQDSPFFISWDFVLRKVPQAEFGMHSAS
TNPSVPSTPTTENNPFKKISSISDMSYLVNKAGNEPIRKGVLIPVQYFDEIEEVLSRALE
VFPLSDRVHKSGSNNALDLAAKRKPLPRPERDELIGVCNIAIRDMEGLDDKEVASRLSKI
MSDYKDELQARRVRRITFVCGHGDGTYPGYFTFRGPSYDEDESIRHSEPALAFQLELGRL
SKFNISPVFTENRNIHVYEAIGKGPAKEAASDKRYFTRAVVRPGRLRDDIPTAEYLISEA
DNLMNDILDALEIIGNNNSDLNHIFINFTPVFQLQPSDVEQALAGFLERFGRRLWRLRVT
GAEIRILCTDNTTGMPYPLRVVITNTSGYIIQVEMYVERKSEKGDWVFHSIGGTTKIGSM
HLRPVTTPYPTKEWLQPKRYKAHLMGTQYVYDFPELFRQAFQNAWADAVASQPSLADKRP
PQGGCMDYSELVLDDSDHLVEVSREPGTNTHGMVGWIITARTPEYPRGRRFVVIANDITY
QIGSFGPQEDKFFHKCTELARKLGIPRVYLSANSGARIGMAEELMPHFSVAWNDPEKPEA
GFKYLYLTPEVKKKLDERKTKDVITELVHDDGEDRYKITTIVGAKDGLGVECLRGSGLIA
GATAKAYEDIFTITLVTCRSVGIGAYLVRLGHRAIQVEGQPIILTGAPAINKLLGREVYT
SNLQLGGTQIMYKNGVSHMTANDDFEGVQKIVQWMSFIPDRKGSSIPIRPSLDPWDRDIA
YYPPPKQTYDVRWLIGGKEDEEGFLPGLFDKDSFQETLGGWARTVVVGRARLGGIPMGVI
AVETRSVDNVTPADPANPDSMEMATTEAGGVWYPNSAFKTAQALKDFNYGEQLPVMILAN
WRGFSGGQRDMYNEVLKYGSYIVDALVKYEQPVFVYIPPFGELRGGSWVVIDPTINPDQM
EMYADEDSRGGILEPEGIVGIKYRREKQLDTMARLDQTYGDLRRSLQDTSLSAEKLSQIK
NKMTERESQLLPVYLQIALQFADLHDRAGRMEAKGTIRKPLQWKNARRFFYWRLRRRLSE
ELILKRMASVTTEPTLDSPEPSRSPSPTTSPGAAEPTVRETNLLTLKAWTGLLDRDFEDD
DRQVSLWYEENKKTLYDRVEAMKTNKVAMQVAQLLMGDKEGGLKGVQQVLSMLPLEEKEA
VLKYLGSS
NT seq 6867 nt NT seq  +upstreamnt  +downstreamnt
atgccagagaccacgaatggctatggcagctcctatgctgcaaagcacaaccttccctcg
cattttattggcggtaaccgcttagatctcgctccgccaggtgcggtcaaggatttcgtt
gcccagcatgatggtcactctgtcattacttctgttctgattgcgaacaatggtattgct
gcggtgaaagaaatcagatcagtccggaaatgggcctacgatacatttggtgatgagcgc
gttattcaattcacggttatggccaccccggaagatcttgaggcaaatgcagattatatt
cgaatggctgatcgatatgtggaggttccgggaggcacgaacaataacaatttcgccaac
gtcgagcttatcgtcgatattgcggagagaatgggtgtccatgcggtgtgggctggctgg
ggccacgcatctgagaacccaaaacttcctgaatctttagcggcttcgccaaagaagatc
attttcatcggccctcccgggtcagctatgagatcgcttggtgacaaaatctcctctact
atcgtcgcgcaacatgctggggtgccgtgtatcccgtggtccggtacgggagtcgatgaa
gttagagttgacgataatggcattgttacagttgaggatagtatttacgaccttggatgc
acacattccccacaagaaggcttggaaaaggccagagctattggttttcccgtcatggtt
aaagcctcggagggaggtggtggaaagggtattcgtaaagtggagagggaggaggacttt
gtcaacctctataacgccgctgcaagtgaaatacccgggtctcccatcttcatcatgaaa
ctcgctgggaatgccaggcatctagaggtccagttgttggctgatcagtatggcaacaac
atatcccttttcggtagggactgctccgttcaacgtcgtcaccaaaagattattgaagag
gcacctgtcactattgcgaaaccggctactttccaggccatggaacgagctgcggtgagg
ctcggaaagctcgtcggatatgtctcgacaggtaccgtggaatatttgtactcccacgcc
gatgacaagttttatttcctagagctgaatccacgattgcaagttgaacatccaactacc
gagatggtcactggagttaatttaccagctgcccagcttcaaattgctatgggtatcccc
ttgcatcgaatccgagatattcgactcttgtacggcgttgatgtcaacaccagttcagag
atcgattttgatttcgccaacgaggatagtcttaaagctcagcgacgccctcagccaaaa
ggtcacaccacagcctgccgtattacctccgaagaccccggcgaaggcttcaagccatct
agcggaacaatgcacgagctcaacttccgcagcagctctaatgtgtggggttacttctct
gttgggacttctggtggcattcataatttttccgattctcaatttggtcatatcttcgcc
tatggagagaatcgatcggcatctagaaaacacatggttatggctctgaaagaattgagt
atccgtggtgacttccgaaccactgtcgaatacctcatcaaacttttagaaacccctgct
ttcgaagacaacaccatcaccaccggctggctcgacgaacttatcaccaaaaaactaacc
gccgaacgcccagaccctgttgtcgcggttatttgtggagctgttgctcaagctcacgta
gcaagtgaagcttgcattgcggaatacaaaaagggccttgaaaagggtcaagtaccagcc
aaagatgtccttaaaacagtgttcacgattgatttcatctatgaggacaccagatacaag
tttaccgcgactagggcaagctccgatagctatcacctgtttataaacggatcgaaatgc
ttggttggcgtccgcgccctggccgatggcggacttcttgtttcgctaaatggacgaagc
cacaatgtgtactggaaagatgagcctgctgccattcgcttaagtgtggatggcaaaact
tgcctccttgaagaagaaaacgaccccacgcaacttcgaacacctagcccaggaaaactg
gtgcattataccgtggaaaacggggcgcatgttaatgccggtgaagtctttgccggaatt
gaagtcatgaagctatatatgcctttgattgctcaagaagatggtgtcgtacaattcatc
aaacagcctggcgcgaccctgcaggcgggagatattctcggtatcctcacattggatgac
ccgtccagagtgaaacatgctcagccgttcctcggacaaatgccagatatgggtcttcct
caagttgtgggtaacaaaccgccgcagcggtttaagctgctccacaatatcttgcaagac
atcctccttggctttgataatcaagttattatgtctcctacgttggcagaattagttgac
gtattgagagagcctgacttgccatacggcgaatggaatgcacaggtttctgcgcttcat
tcccgaatgccacagaaacttgatgcccagctgactcaagtgattgaaaaatcgaaaatc
cgaaaatccgacttccctgctgcgcttttgatgaagacgttcactcgcttcctagacgac
aatgtttctcctgcggacgctgaatcactaaaggtcacgctggatcctttaatccaagta
attcaggactatagcgagggtttgagagtccatgaatacaacgtgatcgccgcccttctg
gagcaatattggaatgtagagcacctttttgcccagagaaatatccgcgatgaggacgtg
atcctgaaattgcgagacgaacacagagacgacattggcaatgtgatccagaccgtgctt
tcccactccaaggttggtggaaaaaacaatttggtgctcgcgattcttgagacataccga
ccaaataaaccaactaccccgaatgttgggaagtatctgaagccaatactgaagaaactg
gcagaccttgaatccagagcttgtgctaaggtcgccttaaaagctcgagaactccttatt
caatgcgctttgccgtctttggaagagcgtatggctcagatggaacatattctacgatct
tctgtcgttcagtcgaaatacggtgagaccggatgggatcatcgagaacccgatattgac
gtgctcaaggaggttgtggactccaagtacacagtctttgacgtccttcctcttttcttt
ggccatcaagatcaatgggtttcattagcagctctcgaagtttatgttcgtcgggcttat
cgggcttatgatctccaaggtgttcaatatcacaatgaccaggacagcccattcttcatt
tcatgggatttcgtcctgcgaaaagttccacaggcagaattcggaatgcacagtgcttcg
actaacccatccgtcccgagcaccccgactacagaaaataacccattcaaaaagatcagc
tccatcagtgacatgtcgtatttagtcaataaagctggaaacgaaccgatccgaaaaggt
gtgttgattcctgtgcagtactttgacgagattgaggaggtactttctcgggctttggaa
gtgttcccactatcagaccgtgttcataaatccggctcaaataacgctctcgacttggct
gcgaaacggaagccactaccacgacctgaacgcgatgaacttatcggcgtttgcaatatc
gctatccgtgatatggagggtcttgacgacaaggaagttgcttcccgactcagcaagatt
atgtcagattataaggacgaattgcaggctcgccgtgttcgaaggataacatttgtctgc
ggccacggggatggaacctaccctggatacttcacttttagaggcccttcatacgacgaa
gatgagagcattcgtcacagtgaacccgccttggccttccaacttgaacttggccgtctg
tccaaattcaatatcagccctgtgttcacggagaatagaaatattcacgtttacgaagca
atcggaaaaggtcccgccaaagaggcggcctctgataaacgatatttcacccgtgctgtt
gtccgacccggccgtctacgagacgatatacccacagcagaatatctgatctccgaagcg
gacaatctgatgaacgatattctggatgctttagaaatcatcggaaataataactctgac
ttaaatcacattttcatcaacttcacgccggttttccagcttcagccatctgacgtggaa
caagcgctggcaggcttcttggaacgattcggtcgacgcctttggcgcctccgtgtcact
ggagccgaaattcgaattctttgcactgacaataccaccggcatgccttatcctcttcgt
gttgtgattaccaatacatcagggtatatcattcaagttgagatgtatgtggaaaggaaa
tctgaaaaaggagactgggtattccatagcattggtggtaccaccaaaattgggtcaatg
caccttcgtccagtgactacgccctacccgacgaaggaatggctccagcctaagcgttac
aaggctcatttaatgggaacccaatacgtttatgatttccctgaacttttccgacaggcc
ttccaaaatgcttgggctgacgctgtcgcttctcagccgtcactcgccgacaagcggcct
cctcagggcggatgtatggactacagtgagctcgttctcgatgattccgatcacttagtc
gaagtttcccgagaacctggaaccaacactcacggcatggttggttggattatcactgca
aggaccccagaatatccccgtggtagacgatttgtcgttattgctaacgatatcacctac
caaattggctctttcgggccacaagaagataagtttttccacaaatgtaccgaacttgcg
agaaaactaggcatcccacgagtctatctgtcggccaattctggtgctcgtatcggcatg
gctgaggaattgatgccacacttctctgttgcttggaacgatcccgagaaaccagaagct
gggttcaagtacctttacttaacaccggaagttaagaagaagctcgacgagcgaaagacg
aaggatgtcatcactgaactcgttcatgacgatggtgaggaccggtacaagattaccact
attgtgggcgccaaagatggactaggtgttgaatgcttgagaggttctggtctcatcgct
ggcgcaaccgcgaaagcctacgaagatatatttaccattactcttgtgacgtgtcgctcc
gtcggtattggtgcctatttagttcgcctaggtcaccgtgccattcaggtggaaggccaa
cctattatcctgacaggcgccccggcgatcaacaagcttcttgggcgagaggtgtataca
tccaacctgcaacttggtggaactcagatcatgtataagaacggcgtctctcatatgaca
gccaacgacgattttgaaggtgttcagaagattgttcaatggatgtcctttatcccagat
cgcaaaggctcttcgatcccgattcggccaagtttggatccatgggatcgtgatattgcg
tactatccacctcctaagcaaacctatgatgtgagatggctcatcggcggtaaggaggat
gaagaaggcttcctccccggtttatttgacaaagactcattccaggaaacgcttggaggc
tgggctcgaactgtcgtggtcggccgtgctagactcggcggaattccaatgggtgtcatt
gcggtcgaaactcgttcagtggacaatgtcaccccggccgatcctgctaatccggattct
atggaaatggccacaactgaagccggcggcgtctggtaccccaactcagcctttaaaacc
gcccaagctttgaaggacttcaattatggcgaacaacttccagttatgatcttggcgaat
tggcgcggtttctcgggtggccagcgtgacatgtacaacgaggtcttgaagtatggttcc
tacatcgtcgacgcgcttgtgaaatatgagcagcctgttttcgtttatattccaccgttt
ggcgagcttcgtggtggctcatgggtcgttatcgatcctaccatcaacccggaccaaatg
gaaatgtatgccgatgaagattcccgtggtggcattctcgaacctgaaggtatcgttggc
attaaatatcgtcgcgagaaacaacttgatactatggctcgcctcgatcaaacctatggc
gacctgcgacgatcgcttcaagacacgtctctcagcgccgaaaaactatcccaaatcaag
aacaagatgactgagcgtgaaagccaattattgcctgtgtatcttcagattgcacttcag
tttgctgatctccacgatcgtgccggtcgcatggaagcaaagggcacaattcgcaaaccc
cttcagtggaagaatgcgcgtcgatttttctactggcgtctccgtcgccgccttagcgaa
gagcttatcctgaaacgcatggcgtctgttactactgagccgacccttgatagtccagag
ccatcaagaagtccatctcctacaacttctcccggagccgcggaaccgactgttcgggaa
actaatcttctgacgcttaaggcttggacaggattattagatagggacttcgaagacgac
gaccgccaagtgtctctctggtatgaagaaaacaagaagacattgtacgaccgggttgag
gcgatgaaaaccaacaaggttgcaatgcaggttgcgcagttattgatgggagacaaagaa
ggcggtttgaagggtgtgcagcaggtattgagcatgctaccgctggaagaaaaggaagct
gttttaaaatacttaggcagctcctaa

DBGET integrated database retrieval system